Gene Details:
- MSU gene ID: LOC_Os01g27140
- RAPdb gene ID: Os01g0368900
- Gene Symbol: OsGrx_C7
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- Overexpression of Rice Glutaredoxin OsGrx_C7 and OsGrx_C2.1 Reduces Intracellular Arsenic Accumulation and Increases Tolerance in Arabidopsis thaliana.
- Gene expression analysis suggested that OsGrx_C7 expression was induced under salt stress and ubiquitously expressed in rice including root and shoot.
- A gain-of-function approach showed that OsGrx_C7 may act as an important determinant in salt stress, compared with WT, and revealed higher biomass accumulation, improved root and plant growth under salt stress.
- CC-type glutaredoxin, OsGrx_C7 plays a crucial role in enhancing protection against salt stress in rice.
- Gene expression analysis, silencing, and overexpression of OsGrx_C7 gene were used to discover the role of OsGrx_C7 in response to salt stress.
- The silencing of OsGrx_C7 gene leads to increased sensitivity to salt stress, indicating its importance in salt stress tolerance.
- Under salt stress condition, OsGrx_C7 overexpressing rice plants showed lower level of lipid peroxidation and Na+/K+ ratio, while proline accumulation, soluble sugar content and GSH/GSSG ratio was higher compared to WT.
- Furthermore, expression analysis suggested that OsGrx_C7 acted as positive regulator of salt tolerance by reinforcing the expression of transporters (OsHKT2;1, OsHKT1;5 and OsSOS1) engaged in Na+ homeostasis in overexpressing plants.
- Overall our study revealed that OsGrx_C7 emerged as a key mediator in response to salt stress in rice and could be used for engineering tolerance against salt stress in rice and other crops.
Function-related keywords:
- tolerance , arsenic-accumulation , root , growth , shoot , salt , salt-tolerance , salt-stress , stress , homeostasis , plant-growth , biomass , sugar , stress-tolerance
Literature:
- Overexpression of rice glutaredoxins (OsGrxs) significantly reduces arsenite accumulation by maintaining glutathione pool and modulating aquaporins in yeast . DOI: 10.1016/j.plaphy.2016.04.052 ; PMID: 27174139
- Overexpression of Rice Glutaredoxin OsGrx_C7 and OsGrx_C2.1 Reduces Intracellular Arsenic Accumulation and Increases Tolerance in Arabidopsis thaliana . DOI: 10.3389/fpls.2016.00740 ; PMID: 27313586
- CC-type glutaredoxin, OsGrx_C7 plays a crucial role in enhancing protection against salt stress in rice . DOI: 10.1016/j.jbiotec.2021.02.008 ; PMID: 33610657
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os01g27140.1
GCACAGCTCAAAGCAAAGCAAAGCACAACACAATCAAAGCCTCATACAAGAAGCTAGCTAGCTAGTACTCAAGCTAAATACCTAGCTAGCAGTAGCAGGCGACCAGCTGCATTTTTCCAGAGGAAAAATCTCTCAGTTTAGCTTAATTAATTAGCTCTTGGGAGAAGAAGGCAAGAAGAAAATGGACAGGGTGAACAGGCTGGCGGCGCAGCGGGCGGTGGTGATCTTCAGCATGAGCTCGTGCTGCATGTGCCACACCGTGACGCGCCTCTTCTGCGAGCTCGGGGTGAACCCGACGGTGGTGGAGCTGGACGAGGACCCGAGGGGGAAGGAGATGGAGAAGGCGCTGGCGAGGCTCCTCGGCCGCAGCCCCGCCGTGCCGGCGGTGTTCATCGGCGGGAGGCTCGTCGGCTCCACCGACAAGGTCATGTCGCTGCACCTCAGCGGCAACCTTGTCCCGCTGCTTCGCAATGCGGGTGCCCTCTGGGTGTAGCACCAACGACGCAACTATACCTACCAGCGACTGGTTCTTGATTTGGACTGATACCGTGGCGCAGAATAATTTTATACGGGTACTTTGGTTTGTATCAGGCAGGTCAGGTATATCTAAGGGAAAATAAATAGTACGTGCAGGCCTTTTTTGCACTGCAATACTAGTAAATCTATAGAGAGTGGGGAATTAAGTGTGTCATGTCAGCCGCCTGTAAGGCTCTTTTGAGATGTAATAATGACACATATCCGTTTAATGGAGTATACCTCTTTTGTCGA
CDS Sequence
- >LOC_Os01g27140.1
ATGGACAGGGTGAACAGGCTGGCGGCGCAGCGGGCGGTGGTGATCTTCAGCATGAGCTCGTGCTGCATGTGCCACACCGTGACGCGCCTCTTCTGCGAGCTCGGGGTGAACCCGACGGTGGTGGAGCTGGACGAGGACCCGAGGGGGAAGGAGATGGAGAAGGCGCTGGCGAGGCTCCTCGGCCGCAGCCCCGCCGTGCCGGCGGTGTTCATCGGCGGGAGGCTCGTCGGCTCCACCGACAAGGTCATGTCGCTGCACCTCAGCGGCAACCTTGTCCCGCTGCTTCGCAATGCGGGTGCCCTCTGGGTGTAG
Protein Sequence
- >LOC_Os01g27140.1
MDRVNRLAAQRAVVIFSMSSCCMCHTVTRLFCELGVNPTVVELDEDPRGKEMEKALARLLGRSPAVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLRNAGALWV*