Information report for OsNPR1;NH1
Gene Details
|
|
Functional Descriptions
- The antisense expression of OsNPR1 (as-npr1), which reduced the expression of the gene by 50%, increased elicited levels of JA and ethylene (ET) as well as of expression of a lipoxygenase gene OsHI-LOX and an ACC synthase gene OsACS2.
- OsNPR1 negatively regulates herbivore-induced JA and ethylene signaling and plant resistance to a chewing herbivore in rice.
- Here, using suppressive substrate hybridization, we identified a NPR1 gene from rice, OsNPR1, and found that its expression levels were upregulated in response to infestation by the rice striped stem borer (SSB) Chilo suppressalis and rice leaf folder (LF) Cnaphalocrocis medinalis, and to mechanical wounding and treatment with jasmonic acid (JA) and salicylic acid (SA).
- Furthermore, two marker genes in defense signaling pathway, OsNPR1 and OsPR1b, were constitutively expressed in OsWRKY71-overexpressing transgenic plants.
- These results suggest that OsWRKY71 might function as a transcriptional regulator upstream of OsNPR1 and OsPR1b in rice defense signaling pathways.
- These effects were diminished by RNAi-knockdown of OsNPR1 or WRKY45, the key regulators of the SA signaling pathway in rice, indicating that the effects of CK depend on these two regulators.
- 1 and NH1, in the establishment of full basal resistance to rice blast.
- OsNPR1/NH1, a rice homolog of NPR1 that is the key regulator of systemic acquired resistance in Arabidopsis thaliana, was shown to be involved in the resistance of rice to bacterial blight disease caused by Xanthomonas oryzae pv.
- Involvement of OsNPR1/NH1 in rice basal resistance to blast fungus Magnaporthe oryzae.
- In our study, three rice homologous genes, OsNPR1/NH1, OsNPR2/NH2 and OsNPR3, were found to be induced by rice bacterial blight Xanthomonas oryzae pv.
- Over-expression of OsNPR1 conferred disease resistance to bacterial blight, but also enhanced herbivore susceptibility in transgenic plants.
- These results indicate that NH1 may be involved in the regulation of SA in response to environmental changes.
- Northern analysis shows that NH1ox rice spontaneously activates defense genes, contrasting with NPR1-overexpressing Arabidopsis, where defense genes are not activated until induction.
- Different subcellular localizations of OsNPR1 antagonistically regulated SA- and jasmonic acid (JA)-responsive genes, but not SA and JA levels, indicating that OsNPR1 might mediate antagonistic cross-talk between the SA- and JA-dependent pathways in rice.
- Wild-type NH1, but not a point mutant corresponding to npr1-1, interacts strongly with the rice transcription factor rTGA2.
- The resistant plants showed increased expression of a subset of defense-responsive genes functioning in the NH1 (an Arabidopsis NPR1 orthologue)-involved defense signal transduction pathway.
- However, when grown in growth chambers (GCs) under low light, NH1ox plants are dwarfed, indicating elevated sensitivity to light.
- Greenhouse-grown NH1ox plants develop lesion-mimic spots on leaves at preflowering stage although no other developmental effects are observed.
- Our results suggest that OsNPR1 is an early responding gene in herbivore-induced defense and that plants can use it to activate a specific and appropriate defense response against invaders by modulating signaling pathways.
- Functional analysis of rice NPR1-like genes reveals that OsNPR1/NH1 is the rice orthologue conferring disease resistance with enhanced herbivore susceptibility.
- TGA transcription factors are well known to participate in NPR1/NH1-mediated defense signaling, which is crucial to systemic acquired resistance in plants.
- However, the role of OsNPR1/NH1 in rice basal resistance to blast fungus M.
- oryzae, thus providing new insights into the role of OsNPR1 in rice disease resistance.
- Rice NRR, a negative regulator of disease resistance, interacts with Arabidopsis NPR1 and rice NH1.
- Silencing of GLO1 results in enhanced resistance to Xoo, increased expression of defense regulators NH1, NH3, and WRKY45, and activation of PR1 expression.
- These results revealed that OsNPR1 is involved in rice basal resistance to the blast pathogen M.
- The GC-grown NH1ox plants show much higher salicylic acid (SA) levels than the wild type, whereas greenhouse-grown NH1ox plants contain lower SA.
- Expression of the rice gene OsNPR1 is induced by salicylic acid (SA).
Functional Keywords
- ethylene , jasmonic , jasmonic-acid , defense , sa , blast , blight , magnaporthe-oryzae , leaf , bacterial-blight , transcription-factor , resistant , ja , dwarf , flower , defense-response , growth , disease-resistance , disease , blight-disease , salicylic-acid , stem
Literature and News
- Mitogen-activated protein kinase OsMPK6 negatively regulates rice disease resistance to bacterial pathogens . DOI: 10.1007/s00425-007-0541-z ; PMID: 17541629
- Involvement of OsNPR1/NH1 in rice basal resistance to blast fungus Magnaporthe oryzae . DOI: 10.1007/s10658-011-9801-7
- Isolation and characterization of the rice NPR1 promoter . DOI: 10.1007/s11816-009-0116-5
- A rice transient assay system identifies a novel domain in NRR required for interaction with NH1/OsNPR1 and inhibition of NH1-mediated transcriptional activation . DOI: 10.1186/1746-4811-8-6 ; PMID: 22353606
- OsWRKY71, a rice transcription factor, is involved in rice defense response . DOI: 10.1016/j.jplph.2006.07.006 ; PMID: 16919842
- Building a mutant resource for the study of disease resistance in rice reveals the pivotal role of several genes involved in defence . DOI: 10.1111/j.1364-3703.2011.00731.x ; PMID: 21726398
- Rice NRR, a negative regulator of disease resistance, interacts with Arabidopsis NPR1 and rice NH1 . DOI: 10.1111/j.1365-313X.2005.02485.x ; PMID: 16115061
- Semi-dominant mutations in the CC-NB-LRR-type R gene, NLS1, lead to constitutive activation of defense responses in rice . DOI: 10.1111/j.1365-313X.2011.04557.x ; PMID: 21418352
- Functional analysis and expressional characterization of rice ankyrin repeat-containing protein, OsPIANK1, in basal defense against Magnaporthe oryzae attack . DOI: 10.1371/journal.pone.0059699 ; PMID: 23555750
- Cytokinins act synergistically with salicylic acid to activate defense gene expression in rice . DOI: 10.1094/MPMI-06-12-0152-R ; PMID: 23234404
- Overexpression of a rice NPR1 homolog leads to constitutive activation of defense response and hypersensitivity to light . DOI: 10.1094/MPMI-18-0511 ; PMID: 15986920
- Reduced expression of glycolate oxidase leads to enhanced disease resistance in rice . DOI: 10.7717/peerj.28 ; PMID: 23638363
- OsNPR1 negatively regulates herbivore-induced JA and ethylene signaling and plant resistance to a chewing herbivore in rice . DOI: 10.1111/j.1399-3054.2012.01666.x ; PMID: 22694163
- Nuclear ubiquitin proteasome degradation affects WRKY45 function in the rice defense program . DOI: 10.1111/tpj.12035 ; PMID: 23013464
- Functional analysis of rice NPR1-like genes reveals that OsNPR1/NH1 is the rice orthologue conferring disease resistance with enhanced herbivore susceptibility . DOI: 10.1111/j.1467-7652.2007.00243.x ; PMID: 17309686
- Functions of rice NAC transcriptional factors, ONAC122 and ONAC131, in defense responses against Magnaporthe grisea . DOI: 10.1007/s11103-012-9981-3 ; PMID: 23103994
- The Systemic Acquired Resistance Regulator OsNPR1 Attenuates Growth by Repressing Auxin Signaling through Promoting IAA-Amido Synthase Expression . DOI: 10.1104/pp.16.00129 ; PMID: 27378815
- Salicylic acid application alleviates cadmium accumulation in brown rice by modulating its shoot to grain translocation in rice . DOI: 10.1016/j.chemosphere.2020.128034 ; PMID: 33297052
- Growth-defence trade-off in rice: fast-growing and acquisitive genotypes have lower expression of genes involved in immunity . DOI: 10.1093/jxb/erad071 ; PMID: 36840921
Gene Resources
- UniProt: Q9FDY4
- EMBL: AK120715, AP002537, AP002746
- AlphaFoldDB: Q9FDY4
- EnsemblPlants: Os01t0194300-01
- Gramene: Os01t0194300-01
- KEGG: dosa:Os01g0194300
- Orthologous matrix: HPAVAFM
- InterPro: IPR000210, IPR002110, IPR011333
- PANTHER: PTHR46475, PTHR46475:SF1
- SUPFAM: SSF48403, SSF54695
- PROSITE: PS50088, PS50097, PS50297
- Gene3D: 1.25.40.20, 3.30.710.10
- OrthoDB: Q9FDY4
- SWISS-MODEL: Q9FDY4
- eggNOG: KOG0504
Sequences
cDNA Sequence
- >LOC_Os01g09800.1
CTCGCGCCTTCCCACCAGCTCGGGCGGGAGGCCTCCTCCTCGCCTCGCCTCGCCACGCCGCGCCGCGACGCGACGCGCCGTGGTCAGCTGGTCGCCGGTGCGGGTGCGGGTGCGCAATGGAGCCGCCGACCAGCCACGTCACCAACGCGTTCTCCGACTCGGACAGCGCGTCCGTGGAGGAGGGGGGCGCCGACGCGGACGCCGACGTGGAGGCGCTCCGCCGCCTCTCCGACAACCTCGCCGCGGCGTTCCGCTCGCCCGAGGACTTCGCGTTCCTCGCCGACGCGCGCATCGCCGTCCCGGGCGGCGGCGGCGGCGGCGGCGACCTGCTGGTGCACCGCTGCGTGCTCTCCGCGCGGAGCCCCTTCCTGCGCGGCGTCTTCGCGCGCCGCGCCGCCGCCGCCGCAGGCGGCGGCGGCGAGGATGGCGGCGAGAGGCTGGAGCTCCGGGAACTCCTCGGCGGCGGCGGCGAGGAGGTGGAGGTCGGGTACGAGGCGCTGCGGCTGGTGCTCGACTACCTCTACAGCGGCCGCGTCGGCGACCTGCCCAAGGCGGCGTGCCTCTGCGTCGACGAGGACTGCGCCCACGTCGGGTGCCACCCCGCCGTCGCGTTCATGGCGCAGGTCCTCTTCGCCGCCTCCACCTTCCAGGTCGCCGAGCTCACCAACCTCTTCCAGCGGCGTCTCCTTGATGTCCTTGATAAGGTTGAGGTAGATAACCTTCTATTGATCTTATCTGTTGCCAACTTATGCAACAAATCTTGCATGAAACTGCTTGAAAGATGCCTTGATATGGTAGTCCGGTCAAACCTTGACATGATTACTCTTGAGAAGTCATTGCCTCCAGATGTTATCAAGCAGATTATTGATGCACGCCTAAGCCTCGGATTAATTTCACCAGAAAACAAGGGATTTCCTAACAAACATGTGAGGAGGATACACAGAGCCCTTGACTCTGACGATGTAGAGCTAGTCAGGATGCTGCTCACTGAAGGACAGACAAATCTTGATGATGCGTTTGCACTGCACTACGCCGTCGAACATTGTGACTCCAAAATTACAACCGAGCTTTTGGATCTCGCACTTGCAGATGTTAATCATAGAAACCCAAGAGGTTATACTGTTCTTCACATTGCTGCGAGGCGAAGAGAGCCTAAAATCATTGTCTCCCTTTTAACCAAGGGGGCTCGGCCAGCAGATGTTACATTCGATGGGAGAAAAGCGGTTCAAATCTCAAAAAGACTAACAAAACAAGGGGATTACTTTGGGGTTACCGAAGAAGGAAAACCTTCTCCAAAAGATAGGTTATGTATTGAAATACTGGAGCAAGCTGAAAGAAGGGACCCACAACTCGGAGAAGCATCAGTTTCTCTTGCAATGGCAGGTGAGAGTCTACGAGGAAGGTTGCTGTATCTTGAAAACCGAGTTGCTTTGGCGAGGATTATGTTTCCGATGGAGGCAAGAGTAGCAATGGATATTGCTCAAGTGGATGGAACTTTGGAATTTAACCTGGGTTCTGGTGCAAATCCACCTCCTGAAAGACAACGGACAACTGTTGATCTAAATGAAAGTCCTTTCATAATGAAAGAAGAACACTTAGCTCGGATGACGGCACTCTCCAAAACAGTGGAGCTCGGGAAACGCTTTTTCCCGCGATGTTCGAACGTGCTCGACAAGATCATGGATGATGAAACTGATCCGGTTTCCCTCGGAAGAGACACGTCCGCGGAGAAGAGGAAGAGGTTTCATGACCTGCAGGATGTTCTTCAGAAGGCATTCCACGAGGACAAGGAGGAGAATGACAGGTCGGGGCTCTCGTCGTCGTCGTCATCGACATCGATCGGGGCCATTCGACCAAGGAGATGAACACCATTGCTCCCAAATAGTTGCCATATTGATAGCTAACTGTCCTCCTGGAGCTACTCACCTGATGGTTGCCTTCTGTCAATTGCCCCCCAAATATATTCTCAATGGTTTAGGCTTGTACAGTATTAGTTCTTACAGCTATTGCCCCGTCAATTGTGAAACGCAGAAGTTTCACTAGTGCTTGTACTCGAGGTGTAATACAAGTGCTTGAATTTTGAGTTGTACTTGGAATTTCCAGTGGTTTGCTCGTAAAAATGAGATGATTTCTTGGCTCCCAAATCTGATAGACTGATGAAATAGACTCTCTGCTTGCTAGTGGTCACCAGAGATGGCTGAAGGCCACTGAAGCATCTACTCTACCAGATATGCACTAAAAACTACACTGTACTTGTTACATCTGGATGAAGCAGTAGAACAGTAAACTCATCTCTTTACTGTTCCCTCTGCCATGTCGAGTGGTAAAAA
CDS Sequence
- >LOC_Os01g09800.1
ATGGAGCCGCCGACCAGCCACGTCACCAACGCGTTCTCCGACTCGGACAGCGCGTCCGTGGAGGAGGGGGGCGCCGACGCGGACGCCGACGTGGAGGCGCTCCGCCGCCTCTCCGACAACCTCGCCGCGGCGTTCCGCTCGCCCGAGGACTTCGCGTTCCTCGCCGACGCGCGCATCGCCGTCCCGGGCGGCGGCGGCGGCGGCGGCGACCTGCTGGTGCACCGCTGCGTGCTCTCCGCGCGGAGCCCCTTCCTGCGCGGCGTCTTCGCGCGCCGCGCCGCCGCCGCCGCAGGCGGCGGCGGCGAGGATGGCGGCGAGAGGCTGGAGCTCCGGGAACTCCTCGGCGGCGGCGGCGAGGAGGTGGAGGTCGGGTACGAGGCGCTGCGGCTGGTGCTCGACTACCTCTACAGCGGCCGCGTCGGCGACCTGCCCAAGGCGGCGTGCCTCTGCGTCGACGAGGACTGCGCCCACGTCGGGTGCCACCCCGCCGTCGCGTTCATGGCGCAGGTCCTCTTCGCCGCCTCCACCTTCCAGGTCGCCGAGCTCACCAACCTCTTCCAGCGGCGTCTCCTTGATGTCCTTGATAAGGTTGAGGTAGATAACCTTCTATTGATCTTATCTGTTGCCAACTTATGCAACAAATCTTGCATGAAACTGCTTGAAAGATGCCTTGATATGGTAGTCCGGTCAAACCTTGACATGATTACTCTTGAGAAGTCATTGCCTCCAGATGTTATCAAGCAGATTATTGATGCACGCCTAAGCCTCGGATTAATTTCACCAGAAAACAAGGGATTTCCTAACAAACATGTGAGGAGGATACACAGAGCCCTTGACTCTGACGATGTAGAGCTAGTCAGGATGCTGCTCACTGAAGGACAGACAAATCTTGATGATGCGTTTGCACTGCACTACGCCGTCGAACATTGTGACTCCAAAATTACAACCGAGCTTTTGGATCTCGCACTTGCAGATGTTAATCATAGAAACCCAAGAGGTTATACTGTTCTTCACATTGCTGCGAGGCGAAGAGAGCCTAAAATCATTGTCTCCCTTTTAACCAAGGGGGCTCGGCCAGCAGATGTTACATTCGATGGGAGAAAAGCGGTTCAAATCTCAAAAAGACTAACAAAACAAGGGGATTACTTTGGGGTTACCGAAGAAGGAAAACCTTCTCCAAAAGATAGGTTATGTATTGAAATACTGGAGCAAGCTGAAAGAAGGGACCCACAACTCGGAGAAGCATCAGTTTCTCTTGCAATGGCAGGTGAGAGTCTACGAGGAAGGTTGCTGTATCTTGAAAACCGAGTTGCTTTGGCGAGGATTATGTTTCCGATGGAGGCAAGAGTAGCAATGGATATTGCTCAAGTGGATGGAACTTTGGAATTTAACCTGGGTTCTGGTGCAAATCCACCTCCTGAAAGACAACGGACAACTGTTGATCTAAATGAAAGTCCTTTCATAATGAAAGAAGAACACTTAGCTCGGATGACGGCACTCTCCAAAACAGTGGAGCTCGGGAAACGCTTTTTCCCGCGATGTTCGAACGTGCTCGACAAGATCATGGATGATGAAACTGATCCGGTTTCCCTCGGAAGAGACACGTCCGCGGAGAAGAGGAAGAGGTTTCATGACCTGCAGGATGTTCTTCAGAAGGCATTCCACGAGGACAAGGAGGAGAATGACAGGTCGGGGCTCTCGTCGTCGTCGTCATCGACATCGATCGGGGCCATTCGACCAAGGAGATGA
Protein Sequence
- >LOC_Os01g09800.1
MEPPTSHVTNAFSDSDSASVEEGGADADADVEALRRLSDNLAAAFRSPEDFAFLADARIAVPGGGGGGGDLLVHRCVLSARSPFLRGVFARRAAAAAGGGGEDGGERLELRELLGGGGEEVEVGYEALRLVLDYLYSGRVGDLPKAACLCVDEDCAHVGCHPAVAFMAQVLFAASTFQVAELTNLFQRRLLDVLDKVEVDNLLLILSVANLCNKSCMKLLERCLDMVVRSNLDMITLEKSLPPDVIKQIIDARLSLGLISPENKGFPNKHVRRIHRALDSDDVELVRMLLTEGQTNLDDAFALHYAVEHCDSKITTELLDLALADVNHRNPRGYTVLHIAARRREPKIIVSLLTKGARPADVTFDGRKAVQISKRLTKQGDYFGVTEEGKPSPKDRLCIEILEQAERRDPQLGEASVSLAMAGESLRGRLLYLENRVALARIMFPMEARVAMDIAQVDGTLEFNLGSGANPPPERQRTTVDLNESPFIMKEEHLARMTALSKTVELGKRFFPRCSNVLDKIMDDETDPVSLGRDTSAEKRKRFHDLQDVLQKAFHEDKEENDRSGLSSSSSSTSIGAIRPRR*