Gene Details:
- MSU gene ID: LOC_Os01g08300
- RAPdb gene ID: Os01g0178300
- Gene Symbol: OsCDT3
- Genome: MSU7 , IRGSP-1.0
- Species: Oryza sativa
Functional Descriptions:
- OsCDT3 was mainly expressed in the roots and its expression was specifically induced by Al exposure, not by low pH and other metals.
- Expression of OsCDT3 in yeast conferred tolerance to Al, but not to Cd.
- Taken together, our results indicate that OsCDT3 anchoring to the plasma membrane may play a role in stopping entry of Al into the root cells by binding Al, therefore, contributing to high Al tolerance in rice.
Function-related keywords:
Literature:
- A plasma membrane-localized small peptide is involved in rice aluminum tolerance . DOI: 10.1111/tpj.12296 ; PMID: 23888867
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >LOC_Os01g08300.1
ATGTACAACCCTCCGGCGGCGCAGGAGATGTCCTACTCCGACCATGTCAAGAAGCGCCATGAGGACAAAGGCTGCCTCTATGCATGCCTGTTCACCCTCTGCTGCTGCTTCTGCTGCTACGAGACCTGCGAGTGCTGCCTCGAATGCCTCTGCTGCTGCTGA
CDS Sequence
- >LOC_Os01g08300.1
ATGTACAACCCTCCGGCGGCGCAGGAGATGTCCTACTCCGACCATGTCAAGAAGCGCCATGAGGACAAAGGCTGCCTCTATGCATGCCTGTTCACCCTCTGCTGCTGCTTCTGCTGCTACGAGACCTGCGAGTGCTGCCTCGAATGCCTCTGCTGCTGCTGA
Protein Sequence
- >LOC_Os01g08300.1
MYNPPAAQEMSYSDHVKKRHEDKGCLYACLFTLCCCFCCYETCECCLECLCCC*