Gene Details:
- Gene ID: MDP0000123888
- Gene Symbol: MdWRKY75
- Gene Name: WRKY transcription factor 75
- Genome: Golden ASM211411v1
- Species: Malus domestica
Functional Descriptions:
- Functional analysis of MdWRKY75 in the regulation of anthocyanin accumulation.
- Overexpressing MdWRKY75 promoted anthocyanin accumulation by activating the expression of MdMYB1 and anthocyanin biosynthetic genes , whereas the opposite trend was observed when we suppressed MdWRKY75 expression.
- MdPHR1 interacted with MdWRKY75 to enhance the MdWRKY75-activated transcription of MdMYB1, the master regulator of anthocyanin biosynthesis, leading to anthocyanin accumulation.
- MdPHR1 interacted with MdWRKY75, a positive regulator of anthocyanin biosynthesis, to enhance the MdWRKY75-activated transcription of MdMYB1, leading to anthocyanin accumulation. In addition, the E3 ubiquitin ligase SEVEN IN ABSENTIA1 (MdSINA1) negatively regulated MdPHR1-promoted anthocyanin biosynthesis via the ubiquitination-mediated degradation of MdPHR1.
- Transient overexpression of MdWRKY75 could significantly increase the sucrose content and promote the expression of MdSWEET1 in apple fruit.
Function-related keywords:
Literature:
- The E3 ubiquitin ligase SINA1 and the protein kinase BIN2 cooperatively regulate PHR1 in apple anthocyanin biosynthesis. DOI: 10.1111/jipb.13538 ; PMID: 37272713
- Comparative physiological and transcriptomic analysis reveal MdWRKY75 associated with sucrose accumulation in postharvest ‘Honeycrisp’ apples with bitter pit. DOI: 10.1186/s12870-022-03453-8 ; PMID: 35176994
Related News:
Gene Resources:
Sequences:
cDNA Sequence
CDS Sequence
- >MDP0000123888
ATGGAAAATTACCCAACATTCTTTTCTTCATCCACATCGCCTGCTCCTTCTTCCTTGTCATTGAACATGGGGAACCCAGCTCATCATGCTTACAATAGTACTGATCTTCGCCAATTCCAAAGTAGTAAATCATCGAATGGGTTCTTAGGGCTGATGTCAGAGATGGGGGCTTCAAACAATATGATTAATAACAATTTTAGTTCTCAGGGAAAAAGCGTTGGAGGATCTGGAACTAGTRCGCCAACTGTGAGATTAGGGATGAAAAAAGGAGATCAGAAAAAAATAAGAAAGCCGAGACATGCTTTTYAAACAAGGAGTCAAGTTGATATACTTGATGATGGATATAGATGGAGGAAGTATGGTCAAAAAGCAGTGAAGAACAACAAATTTCCAAGAAGCTACTACCGATGCACCCATCAGGGCTGCAATGTGAAAAAGCAAGTTCAAAGGTTAACGAAAGATGAAGGAGTCGTTGTGACAACTTATGAAGGCATGCATTCTCATCCCATCGAGAAGAGTACTGATAACTTTGAGCATATTTTGAGCCAGATGCAAATCTACACTTCATTTTAA
Protein Sequence
- >MDP0000123888
MENYPTFFSSSTSPAPSSLSLNMGNPAHHAYNSTDLRQFQSSKSSNGFLGLMSEMGASNNMINNNFSSQGKSVGGSGTSXPTVRLGMKKGDQKKIRKPRHAFXTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHPIEKSTDNFEHILSQMQIYTSF