Gene Details:

Functional Descriptions:

  • The ubiquitin-binding protein MdRAD23D1 mediates drought response by regulating degradation of the proline-rich protein MdPRP6 in apple.
  • Demonstrated that MdRAD23D1 interacted with a proline-rich protein MdPRP6, resulting in the degradation of MdPRP6 by the 26S proteasome.
  • Suppression of MdPRP6 resulted in enhanced drought tolerance in apple plants, mainly because the free proline accumulation is changed.
  • MdRAD23D1 levels increased under drought, accelerating the degradation of MdPRP6. MdPRP6 negatively regulated drought response, probably by regulating proline accumulation.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Sequences:

cDNA Sequence
mRNA Sequence
  • />MD15G1126700
    ATGCCTTCTACCAAGCAGCTCTCAGCAACCCTCCTCATCTTCTCAATCCTTTTCTACTCATCCACATTCTCCATTGCTTGCGGCACATGCAAGCCTGCTCTAGCGCCCGCGCCTATGGCTGAAACCTGTCCTAAAGACACACTGAAGCTAGGGGCTTGTGTGGACCTTCTAGGACTTGTCAACCTCCAAATCGGAAGCCCGCCTACAAGTGGTTGCTGTGCGTTGCTTGAAGGGTTGTCCGATTTGGAGGCTGCTATTTGCCTCTGCACTGTGATCAAGGCCAATGCGCTAGGGCTCAACATGGAAGTGCCAGTAGCTTTGAGCTTGCTTGTTAGTGCCTGCCAGAAAACAGTCCCTCCTGGCTTCAAATGTGAATGA
Protein Sequence
  • />MD15G1126700
    MPSTKQLSATLLIFSILFYSSTFSIACGTCKPALAPAPMAETCPKDTLKLGACVDLLGLVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALGLNMEVPVALSLLVSACQKTVPPGFKCE