Gene Details:
- Gene ID: MD15G1126700
- Gene Symbol: MdPRP6
- Gene Name:
- Genome: Golden ASM211411v1
- Species: Malus domestica
Functional Descriptions:
- The ubiquitin-binding protein MdRAD23D1 mediates drought response by regulating degradation of the proline-rich protein MdPRP6 in apple.
- Demonstrated that MdRAD23D1 interacted with a proline-rich protein MdPRP6, resulting in the degradation of MdPRP6 by the 26S proteasome.
- Suppression of MdPRP6 resulted in enhanced drought tolerance in apple plants, mainly because the free proline accumulation is changed.
- MdRAD23D1 levels increased under drought, accelerating the degradation of MdPRP6. MdPRP6 negatively regulated drought response, probably by regulating proline accumulation.
Function-related keywords:
Literature:
- The ubiquitin-binding protein MdRAD23D1 mediates drought response by regulating degradation of the proline-rich protein MdPRP6 in apple (Malus domestica). DOI: 10.1111/pbi.14057 ; PMID: 37140026
Related News:
Gene Resources:
Sequences:
cDNA Sequence
mRNA Sequence
- />MD15G1126700
ATGCCTTCTACCAAGCAGCTCTCAGCAACCCTCCTCATCTTCTCAATCCTTTTCTACTCATCCACATTCTCCATTGCTTGCGGCACATGCAAGCCTGCTCTAGCGCCCGCGCCTATGGCTGAAACCTGTCCTAAAGACACACTGAAGCTAGGGGCTTGTGTGGACCTTCTAGGACTTGTCAACCTCCAAATCGGAAGCCCGCCTACAAGTGGTTGCTGTGCGTTGCTTGAAGGGTTGTCCGATTTGGAGGCTGCTATTTGCCTCTGCACTGTGATCAAGGCCAATGCGCTAGGGCTCAACATGGAAGTGCCAGTAGCTTTGAGCTTGCTTGTTAGTGCCTGCCAGAAAACAGTCCCTCCTGGCTTCAAATGTGAATGA
Protein Sequence
- />MD15G1126700
MPSTKQLSATLLIFSILFYSSTFSIACGTCKPALAPAPMAETCPKDTLKLGACVDLLGLVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALGLNMEVPVALSLLVSACQKTVPPGFKCE