Gene Details:
- Gene ID: MDP0000757701
- Gene Symbol: MdJAZ18MdJAZ2
- Gene Name: jasmonate ZIM-domain protein 18
- Genome: Golden ASM211411v1
- Species: Malus domestica
Functional Descriptions:
- MdSnRK1.1 interacts with MdJAZ18 to regulate sucrose-induced anthocyanin and proanthocyanidin accumulation in apple.
- MdSnRK1.1 then phosphorylated MdJAZ18 to facilitate its 26S proteasome-mediated degradation, which released MdbHLH3 thereby activating the expression of the regulatory and structural genes, thus finally promoting the biosynthesis of anthocyanins and PAs.
- MdJAZ18 is involved in MdSnRK1.1-induced anthocyanin and PA accumulation.
- These findings suggested that MdJAZ18 was involved in MdSnRK1.1-induced anthocyanin and PA accumulation by modulating the expression of the regulatory and structural genes.
- The jasmonate-ZIM domain (JAZ) proteins MdJAZ1 and MdJAZ2 negatively modulate MdABI4-improved cold tolerance in apple by interacting with the MdABI4 protein.
- MdJAZ1 and MdJAZ2 negatively regulated cold tolerance by attenuating the interaction between the MdABI4 and MdICE1 proteins.
- The results showed that compared with MdABI4-overexpressing transgenic apple leaves (MdABI4-OX), MdJAZ1-OX/MdABI4-OX and MdJAZ2-OX/MdABI4-OX transgenic apple leaves accumulated more ROS after cold stress treatment, suggesting that the overexpression of MdJAZ1 or MdJAZ2 decreased MdABI4-improved cold tolerance in apple leaves.
- MdJAZ1 and MdJAZ2 negatively regulate MdABI4-improved cold tolerance.
Function-related keywords:
- sucrose , anthocyanin-biosynthesis , proanthocyanidin , anthocyanin , stress , jasmonate , tolerance , cold-tolerance , cold-stress , cold , stress-tolerance , protein
Literature:
- MdSnRK1.1 interacts with MdJAZ18 to regulate sucrose-induced anthocyanin and proanthocyanidin accumulation in apple. DOI: 10.1093/jxb/erx150 ; PMID: 28549152
- Abscisic acid insensitive 4 interacts with ICE1 and JAZ proteins to regulate ABA signaling-mediated cold tolerance in apple. DOI: 10.1093/jxb/erab433 ; PMID: 34555166
Related News:
Gene Resources:
Orthologs:
Sequences:
cDNA Sequence
CDS Sequence
- >MDP0000757701
ATGGAGAGAGATTTCTTGGGTTTGAACTCAAAGGAGCCAGTGGTTGTGGTGAAGGAGGAGACCAACAACGATGGCGGCAAAGACCCAGGGTATGGAAGAGGTGGAAGGGCACATTGGCCCTTTCTAAGCCAGGTCTCTGCAGTTCCTCAGTTTATGTCCTTCAAAGCTGCTCAAGATGATAGGACTAAAAAAATGGTACCTGATTCATTCTTGTCTTCCGTCTCTGCGGGTGCATTTGACCCTTGTCAAAAACAAACTACATGTGAATCTCAGAAGAACTTCAATCACGATAGGCAAGGTGGGATTCATTTTTCTCTGACAGCTTATCCTAGGCAACGTTATATGCATTCTGTGCACCGTCCTCATGACACAAAGATGATTTCAGTTACCAGTCAAGGGATTTCTGTTCCAATGAGCAACCCTTACTTGAAGAATCACTTTACTACTACTGGTCAGAATTTTTCCACAACTACSATGAAGCATACGGCTCCACCTTCAGCTCTTCCCGTTACAGGTGGTTCCATTGCTGGGATCACTGAGCCGTGGAACAATGTCAAGACCTCTGGGTCACCTTCACAATTGACAATCTTTTACGCTGGTACTGTGAATGTCTATGATGATATCTCCCCTGAGAAGGCTCAGGCACTGATGCTTTTGGCTGGAAACAGTTGTTCTAACTCCTCTAGTGCTGCACAGCCCAAAGCTCAAGCACCGAGTGCAAAGTTGGCAGCGGAAGACGGTGTTCCTGTGAATCAGCGTACAAATATACCCCCACCTGCTCTTTCTAGCCCCTTATCATCTGTTTCTTCACATACTGGTTCCCAGTCAGTAAGTGGGTCCTCCAGCACTGATGAACTAATGTCAGCTAGAACGACCGGACGTCCAACCAGTCCTGTTAACAAAATGGAGGCTCCAGAAACAGCAAATGCAGTTCGATCTGTTGCTGCGACTTCTATGATTCCTTCTGCTGTTCCACAGGCTCGCAAAGCATCCTTGGCTCGATTTTTAGAGAAGCGCAAGGAAAGGTGA
Protein Sequence
- >MDP0000757701
MERDFLGLNSKEPVVVVKEETNNDGGKDPGYGRGGRAHWPFLSQVSAVPQFMSFKAAQDDRTKKMVPDSFLSSVSAGAFDPCQKQTTCESQKNFNHDRQGGIHFSLTAYPRQRYMHSVHRPHDTKMISVTSQGISVPMSNPYLKNHFTTTGQNFSTTTMKHTAPPSALPVTGGSIAGITEPWNNVKTSGSPSQLTIFYAGTVNVYDDISPEKAQALMLLAGNSCSNSSSAAQPKAQAPSAKLAAEDGVPVNQRTNIPPPALSSPLSSVSSHTGSQSVSGSSSTDELMSARTTGRPTSPVNKMEAPETANAVRSVAATSMIPSAVPQARKASLARFLEKRKER*