Information report for MdMYB1
Gene Details
|
|
Functional Descriptions
- MdPHR1 interacted with MdWRKY75, a positive regulator of anthocyanin biosynthesis, to enhance the MdWRKY75-activated transcription of MdMYB1, leading to anthocyanin accumulation. In addition, the E3 ubiquitin ligase SEVEN IN ABSENTIA1 (MdSINA1) negatively regulated MdPHR1-promoted anthocyanin biosynthesis via the ubiquitination-mediated degradation of MdPHR1.
- The MdMYB1 locus is methylated through binding of MdAGO4s to the MdMYB1 promoter to regulate anthocyanin biosynthesis by the RdDM pathway.
- Overexpressing MdWRKY75 promoted anthocyanin accumulation by activating the expression of MdMYB1 and anthocyanin biosynthetic genes, whereas the opposite trend was observed when we suppressed MdWRKY75 expression.
- MdMYB1, encoding the master regulator of anthocyanin biosynthesis in apple.
- Ethylene precisely regulates anthocyanin synthesis in apple via a module comprising MdEIL1, MdMYB1, and MdMYB17.
- ABI5 regulates ABA-induced anthocyanin biosynthesis by modulating the MYB1-bHLH3 complex in apple.
- Our results demonstrate that the dynamic regulatory module MdBT2-MdTCP46-MdMYB1 plays a key role in modulating anthocyanin biosynthesis at different light intensities in apple, and provides new insights into the post-transcriptional regulation of TCP proteins.
- EIN3-LIKE1,MYB1, and ETHYLENE RESPONSE FACTOR3 Act in a Regulatory Loop That Synergistically Modulates Ethylene Biosynthesis and Anthocyanin Accumulation
- These results suggested that ethylene promoted apple anthocyanin synthesis and fruit coloration through regulating the transcription of MdMYB1 and anthocyanin synthetic genes.
- EIN3-LIKE1, MYB1, and ETHYLENE RESPONSE FACTOR3 Act in a Regulatory Loop That Synergistically Modulates Ethylene Biosynthesis and Anthocyanin Accumulation.
- Our findings provide insight into a mechanism involving the synergistic interaction of the ethylene signal with the MdMYB1 transcription factor to regulate ethylene biosynthesis and fruit coloration in apple.
- The small ubiquitin-like modifier E3 ligase MdSIZ1 promotes anthocyanin accumulation by sumoylating MdMYB1 under low-temperature conditions in apple.
- Epigenetic regulation of MdMYB1 is associated with paper bagging-induced red pigmentation of apples.
Functional Keywords
Literature and News
- The E3 ubiquitin ligase SINA1 and the protein kinase BIN2 cooperatively regulate PHR1 in apple anthocyanin biosynthesis. DOI: 10.1111/jipb.13538 ; PMID: 37272713
- Methylation of MdMYB1 locus mediated by RdDM pathway regulates anthocyanin biosynthesis in apple. DOI: 10.1111/pbi.13337 ; PMID: 31930634
- Ethylene precisely regulates anthocyanin synthesis in apple via a module comprising MdEIL1, MdMYB1, and MdMYB17. DOI: 10.1093/hr/uhac034 ; PMID: 35184186
- ABI5 regulates ABA-induced anthocyanin biosynthesis by modulating the MYB1-bHLH3 complex in apple. DOI: 10.1093/jxb/eraa525 ; PMID: 33159793
- Dynamic regulation of anthocyanin biosynthesis at different light intensities by the BT2-TCP46-MYB1 module in apple. DOI: 10.1093/jxb/eraa056 ; PMID: 31996900
- EIN3-LIKE1, MYB1, and ETHYLENE RESPONSE FACTOR3 Act in a Regulatory Loop That Synergistically Modulates Ethylene Biosynthesis and Anthocyanin Accumulation. DOI: 10.1104/pp.18.00068 ; PMID: 29925585
- The small ubiquitin-like modifier E3 ligase MdSIZ1 promotes anthocyanin accumulation by sumoylating MdMYB1 under low-temperature conditions in apple. DOI: 10.1111/pce.12978 ; PMID: 28440563
- Epigenetic regulation of MdMYB1 is associated with paper bagging-induced red pigmentation of apples. DOI: 10.1007/s00425-016-2524-4 ; PMID: 27105885
Gene Resources
- NCBI ID: HM122614.1
- UniProt accessions: S4S5M5
Sequences
cDNA Sequence
CDS Sequence
- >MDP0000259614
ATGGAGGGATATAACGAAAACCTGAGTGTGAGAAAAGGTGCCTGGACTCGAGAGGAAGACAATCTTCTCAGGCAGTGCAGGAAGAGCTGCAGACAAAGATGGTTAAACTATCTGAAGCCAAATATCAAGAGAGGAGACTTTAAAGAGGATGAAGTAGATCTTATAATTAGACTTCACAGGCTTTTGGGAAACAGGTGGTCATTGATTGCTAGAAGACTTCCAGGAAGAACAGCAAATGCTGTGAAAAATTATTGGAACACTCGATTGCGGATCGATTCTCGCATGAAAACGGTGAAAAATAAATCTCAAGAAATGAGAAAGACCAATGTGATAAGACCTCAGCCCCAAAAATTCAACAGAAGTTCATATTACTTAAGCAGTAAAGAACCAATTCTAGACCATATTCAATCAGCAGAAGATTTAAGTACGCCACCACAAACGTCGTCGTCAACAAAGAATGGAAATGATTGGTGGGAGACCTTGTTAGAAGGCGAGGATACTTTTGAAAGWGCTGCATATCCCAGCATTGAGTTAGAGGAAGAACTCTTCACAAGTTTTTGGTTTGATGATCGACTGTCGCCAAGATCATGCGCCAATTTTCCTGAAGGACAAAGTAGAAGTGAATTCTCCTTTAGCACGGACCTTTGGAATCATTCAAAAGAAGAATAG
Protein Sequence
- >MDP0000259614
MEGYNENLSVRKGAWTREEDNLLRQCRKSCRQRWLNYLKPNIKRGDFKEDEVDLIIRLHRLLGNRWSLIARRLPGRTANAVKNYWNTRLRIDSRMKTVKNKSQEMRKTNVIRPQPQKFNRSSYYLSSKEPILDHIQSAEDLSTPPQTSSSTKNGNDWWETLLEGEDTFEXAAYPSIELEEELFTSFWFDDRLSPRSCANFPEGQSRSEFSFSTDLWNHSKEE