Gene Details:

Functional Descriptions:

  • MdPHR1 interacted with MdWRKY75, a positive regulator of anthocyanin biosynthesis, to enhance the MdWRKY75-activated transcription of MdMYB1, leading to anthocyanin accumulation. In addition, the E3 ubiquitin ligase SEVEN IN ABSENTIA1 (MdSINA1) negatively regulated MdPHR1-promoted anthocyanin biosynthesis via the ubiquitination-mediated degradation of MdPHR1.
  • The MdMYB1 locus is methylated through binding of MdAGO4s to the MdMYB1 promoter to regulate anthocyanin biosynthesis by the RdDM pathway.
  • Overexpressing MdWRKY75 promoted anthocyanin accumulation by activating the expression of MdMYB1 and anthocyanin biosynthetic genes, whereas the opposite trend was observed when we suppressed MdWRKY75 expression.
  • MdMYB1, encoding the master regulator of anthocyanin biosynthesis in apple.
  • Ethylene precisely regulates anthocyanin synthesis in apple via a module comprising MdEIL1, MdMYB1, and MdMYB17.
  • ABI5 regulates ABA-induced anthocyanin biosynthesis by modulating the MYB1-bHLH3 complex in apple.
  • Our results demonstrate that the dynamic regulatory module MdBT2-MdTCP46-MdMYB1 plays a key role in modulating anthocyanin biosynthesis at different light intensities in apple, and provides new insights into the post-transcriptional regulation of TCP proteins.
  • EIN3-LIKE1,MYB1, and ETHYLENE RESPONSE FACTOR3 Act in a Regulatory Loop That Synergistically Modulates Ethylene Biosynthesis and Anthocyanin Accumulation
  • These results suggested that ethylene promoted apple anthocyanin synthesis and fruit coloration through regulating the transcription of MdMYB1 and anthocyanin synthetic genes.
  • EIN3-LIKE1, MYB1, and ETHYLENE RESPONSE FACTOR3 Act in a Regulatory Loop That Synergistically Modulates Ethylene Biosynthesis and Anthocyanin Accumulation.
  • Our findings provide insight into a mechanism involving the synergistic interaction of the ethylene signal with the MdMYB1 transcription factor to regulate ethylene biosynthesis and fruit coloration in apple.
  • The small ubiquitin-like modifier E3 ligase MdSIZ1 promotes anthocyanin accumulation by sumoylating MdMYB1 under low-temperature conditions in apple.
  • Epigenetic regulation of MdMYB1 is associated with paper bagging-induced red pigmentation of apples.

Literature:

Gene Resources:

Sequences:

cDNA Sequence
CDS Sequence
  • >MDP0000259614
    ATGGAGGGATATAACGAAAACCTGAGTGTGAGAAAAGGTGCCTGGACTCGAGAGGAAGACAATCTTCTCAGGCAGTGCAGGAAGAGCTGCAGACAAAGATGGTTAAACTATCTGAAGCCAAATATCAAGAGAGGAGACTTTAAAGAGGATGAAGTAGATCTTATAATTAGACTTCACAGGCTTTTGGGAAACAGGTGGTCATTGATTGCTAGAAGACTTCCAGGAAGAACAGCAAATGCTGTGAAAAATTATTGGAACACTCGATTGCGGATCGATTCTCGCATGAAAACGGTGAAAAATAAATCTCAAGAAATGAGAAAGACCAATGTGATAAGACCTCAGCCCCAAAAATTCAACAGAAGTTCATATTACTTAAGCAGTAAAGAACCAATTCTAGACCATATTCAATCAGCAGAAGATTTAAGTACGCCACCACAAACGTCGTCGTCAACAAAGAATGGAAATGATTGGTGGGAGACCTTGTTAGAAGGCGAGGATACTTTTGAAAGWGCTGCATATCCCAGCATTGAGTTAGAGGAAGAACTCTTCACAAGTTTTTGGTTTGATGATCGACTGTCGCCAAGATCATGCGCCAATTTTCCTGAAGGACAAAGTAGAAGTGAATTCTCCTTTAGCACGGACCTTTGGAATCATTCAAAAGAAGAATAG
Protein Sequence
  • >MDP0000259614
    MEGYNENLSVRKGAWTREEDNLLRQCRKSCRQRWLNYLKPNIKRGDFKEDEVDLIIRLHRLLGNRWSLIARRLPGRTANAVKNYWNTRLRIDSRMKTVKNKSQEMRKTNVIRPQPQKFNRSSYYLSSKEPILDHIQSAEDLSTPPQTSSSTKNGNDWWETLLEGEDTFEXAAYPSIELEEELFTSFWFDDRLSPRSCANFPEGQSRSEFSFSTDLWNHSKEE