Gene Details:
- Gene ID: MDP0000586302
- Gene Symbol: MdHY5
- Gene Name: Malus domestica LONG HYPOCOTYL 5
- Genome: Golden ASM211411v1
- Species: Malus domestica
Functional Descriptions:
- Gene expression analysis showed that overexpression of MdPIF7 decreased the expression of anthocyanin biosynthesis-related genes (MdHY5, MdDFR, MdUF3GT, MdCHI, MdCHS, and MdANS), while suppression of MdPIF7 increased the expression of those genes.
- RT-qPCR results showed that several anthocyanin biosynthesis-related genes (MdHY5, MdDFR, MdUF3GT, MdCHI, MdCHS, and MdANS) were induced in MdBBX23-overexpressing calli, but expression of these genes (MdHY5, MdDFR, MdCHS, and MdANS) was inhibited in MdBBX23 suppression expression calli.
- MdBBX23 positively regulates anthocyanin accumulation and hypocotyl elongation inhibition by activating MdHY5.
- Further investigation showed that MdPIF7 functioned by interacting with B-box 23 (MdBBX23), a positive regulator of anthocyanin biosynthesis in apple and hypocotyl growth inhibition in ectopically expressed Arabidopsis, and attenuating the transcriptional activation of MdBBX23 on LONG HYPOCOTYL 5 (MdHY5).
- Melatonin confers tolerance to nitrogen deficiency through regulating MdHY5 in apple plants.
- The MdHY5-MdWRKY41-MdMYB transcription factor cascade regulates the anthocyanin and proanthocyanidin biosynthesis in red-fleshed apple.
- An Apple B-Box Protein MdBBX37 Modulates Anthocyanin Biosynthesis and Hypocotyl Elongation Synergistically with MdMYBs and MdHY5.
- We obtained transgenic apple calli that overexpressed the MdHY5 gene, and apple calli coloration assays showed that MdHY5 promoted anthocyanin accumulation by regulating expression of the MdMYB10 gene and downstream anthocyanin biosynthesis genes.
Function-related keywords:
Literature:
- Phytochrome interacting factor MdPIF7 modulates anthocyanin biosynthesis and hypocotyl growth in apple. DOI: 10.1093/plphys/kiab605 ; PMID: 34983053
- The MdHY5-MdWRKY41-MdMYB transcription factor cascade regulates the anthocyanin and proanthocyanidin biosynthesis in red-fleshed apple. DOI: 10.1016/j.plantsci.2021.110848 ; PMID: 33775373
- Melatonin confers tolerance to nitrogen deficiency through regulating MdHY5 in apple plants. DOI: 10.1111/tpj.16542 ; PMID: 37966861
- An Apple B-Box Protein MdBBX37 Modulates Anthocyanin Biosynthesis and Hypocotyl Elongation Synergistically with MdMYBs and MdHY5. DOI: 10.1093/pcp/pcz185 ; PMID: 31550006
- The bZIP transcription factor MdHY5 regulates anthocyanin accumulation and nitrate assimilation in apple. DOI: 10.1038/hortres.2017.56 ; PMID: 28611922
Related News:
Gene Resources:
Sequences:
cDNA Sequence
CDS Sequence
- >MDP0000586302
ATGCAAGAGCAGGCGACGAGCTCCCTCGCTGCGAGCTCTCTGCCTTCCAGYAGCGAAAGGTCTTCGAGCTCTGCATTCCATCTTGAAGTTAAAGAAGGCATGGAAAGCGACGAGGAGATCGGAAGAGTGCCGGAAATCGGCGGCGAATCGGCAGGAGCGTCGGCTTCCGCCCGGGAAAACGGCTTGTTGGCCGGTCCAGACCAGGTCCAAACGGCTGGTGAGAGTCAGAGAAAGAGAGGAAGAAATCCAGCAGACAAGGAAAGCAAGCGGCTGAAGAGGTTGTTGAGGAACAGAGTTTCAGCACAGCAAGCAAGGGAGAGGAAGAAGGCATATTTGAATGATTTGGAAGTGAGAGTCAAAGAATTGGAGCAGAAGAATTCTGAGCTTGATGAGAGGCTTTCCACTTTGCAGAATGAGAATCAGATGCTTAGACATATATTGAAGAACACAACGGCAAGCCGGAGAGGARCAGATGGTGGTGCAAATGCGGATTGA
Protein Sequence
- >MDP0000586302
MQEQATSSLAASSLPSSSERSSSSAFHLEVKEGMESDEEIGRVPEIGGESAGASASARENGLLAGPDQVQTAGESQRKRGRNPADKESKRLKRLLRNRVSAQQARERKKAYLNDLEVRVKELEQKNSELDERLSTLQNENQMLRHILKNTTASRRGXDGGANAD*