Gene Details:
- Gene ID: MDP0000521934
- Gene Symbol: MdbZIP44
- Gene Name: bZIP transcription factor 44
- Genome: Golden ASM211411v1
- Species: Malus domestica
Functional Descriptions:
- MdWRKY40 and MdbZIP44 were identified as positive regulators of leaf senescence.
- We also identified two positive regulators of leaf senescence, MdWRKY40 and MdbZIP44, which directly interacted with MdABI5 and promoted MdABI5-mediated leaf senescence by enhancing the transcriptional activity of MdABI5 on MdNYE1 and MdNYC1.
- MdbZIP44 and MdWRKY40 promote leaf senescence by enhancing the transcriptional activity of MdABI5.
- Apple bZIP transcription factor MdbZIP44 regulates abscisic acid-promoted anthocyanin accumulation.
- MdbZIP44, an ABA-induced bZIP TF in apple, and characterized its function to participate in ABA-modulated anthocyanin biosynthesis. Further study revealed that MdbZIP44 interacted with MdMYB1 and enhanced the binding of MdMYB1 to its downstream genes.
- In addition, MdBT2, an MdbZIP44-interacting protein, accelerated the protein degradation of MdbZIP44 through the 26S proteasome pathway.
Function-related keywords:
- leaf , leaf-senescence , senescence , aba
Literature:
- MdABI5 works with its interaction partners to regulate abscisic acid-mediated leaf senescence in apple. DOI: 10.1111/tpj.15132 ; PMID: 33314379
- Apple bZIP transcription factor MdbZIP44 regulates abscisic acid-promoted anthocyanin accumulation. DOI: 10.1111/pce.13393 ; PMID: 29940702
Related News:
Gene Resources:
Sequences:
cDNA Sequence
CDS Sequence
- >MDP0000521934
ATGGCTTCTTCAAGCGGAAATTCCTCTGGTTCCACTCAGCTTCAGAACTCTGGCTCCGAAGGGGATCTGCATCATCTGGTKGATCAAAGAAAGAGAAAACGGATGCAGTCGAACCGCGAATCGGCGCGGCGGTCCCGGATGCGGAAGCAGCAGCACCTGGACGATCTGACGGCGCAGGTCGCCCAGCTGCGGAAGGAGAACAAYCAAATCCTGACCAGCATAAACATCACCACCCAGCACYACATGAATGTCGAGTCGGAAAACTCGGTCTTGAAAGCGCAGATGGCGGAGCTCAGCCAGAGACTGGAGTCRCTCAACGAGATCCTMGGTTACATCRACGCCGGCGRCGGTTACGGCGGAGACTTTGAAACCACCCCGRTTGCCGATCACAACAGCTTCATAAACCCTTGGAACATGCTTTATGTTAACCAACCAATCATGGCCACTGCCGACATGCTTCACCAATACTAA
Protein Sequence
- >MDP0000521934
MASSSGNSSGSTQLQNSGSEGDLHHLVDQRKRKRMQSNRESARRSRMRKQQHLDDLTAQVAQLRKENNQILTSINITTQHXMNVESENSVLKAQMAELSQRLESLNEILGYIXAGXGYGGDFETTPXADHNSFINPWNMLYVNQPIMATADMLHQY*