Gene Details:

Functional Descriptions:

  • MdWRKY11 improves copper tolerance by directly promoting the expression of the copper transporter gene MdHMA5.
  • MdHMA5 is a Cu transporter that may function in the storage of excess Cu in root cell walls and stems for Cu tolerance in apple.
  • Demonstrated that MdWRKY11 directly binds to the promoter of MdHMA5, which encodes a P1B ATPase, and activates its expression. MdHMA5 functions in Cu transport and decreases Cu accumulation in apple plants.
  • MdHMA5, which is directly regulated by MdWRKY11 and functions in transmembrane Cu transport, is possibly required for the extrusion or redistribution of Cu in apple.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Orthologs:

Sequences:

cDNA Sequence
mRNA Sequence
  • />MD03G1182600
    ATGTGTGTGTTGGTTTCCATTGATGGAAAGATTGCTGGGTCTTTTGCTGTAACTGATCCAGTGAAGCTAGAGGCTGCACGAGTCATCTCTTATCTTCACTCGATAAACATTACAAGCATCATGGTTACTGGTGATAACTGGGCTACAGCGGCAGCCAGAGTGATGGAGGTTGGCATTGATAAGCTGTATGCTGAGACGGATCCACTAGGAAAAGCTGATAGAATCAAAGAATTACAGTTACGATTATATTATAGTTACAGGGGTGGTGTGAGTGGATTACAATTACCCAGCTCCACAAGTAATTTTGTTCGGGTTTTGAACGCAGATTGAGGATTACTAAATTATATTTCAAATGACTTATCTAGGATGAAAGGAATGGCGGTGGCAATGATGGGAGATGGAATTAATGACTCT
Protein Sequence
  • />MD03G1182600
    MCVLVSIDGKIAGSFAVTDPVKLEAARVISYLHSINITSIMVTGDNWATAAARVMEVGIDKLYAETDPLGKADRIKELQLRLYYSYRGGVSGLQLPSSTSNFVRVLNAD