Gene Details:
- Gene ID: Md03G1182600
- Gene Symbol: MdHMA5
- Gene Name:
- Genome: Golden ASM211411v1
- Species: Malus domestica
Functional Descriptions:
- MdWRKY11 improves copper tolerance by directly promoting the expression of the copper transporter gene MdHMA5.
- MdHMA5 is a Cu transporter that may function in the storage of excess Cu in root cell walls and stems for Cu tolerance in apple.
- Demonstrated that MdWRKY11 directly binds to the promoter of MdHMA5, which encodes a P1B ATPase, and activates its expression. MdHMA5 functions in Cu transport and decreases Cu accumulation in apple plants.
- MdHMA5, which is directly regulated by MdWRKY11 and functions in transmembrane Cu transport, is possibly required for the extrusion or redistribution of Cu in apple.
Function-related keywords:
- root , stems , atpase , tolerance , transporter , copper-accumulation , copper
Literature:
- MdWRKY11 improves copper tolerance by directly promoting the expression of the copper transporter gene MdHMA5. DOI: 10.1038/s41438-020-0326-0 ; PMID: 32637133
Related News:
Gene Resources:
Orthologs:
Sequences:
cDNA Sequence
mRNA Sequence
- />MD03G1182600
ATGTGTGTGTTGGTTTCCATTGATGGAAAGATTGCTGGGTCTTTTGCTGTAACTGATCCAGTGAAGCTAGAGGCTGCACGAGTCATCTCTTATCTTCACTCGATAAACATTACAAGCATCATGGTTACTGGTGATAACTGGGCTACAGCGGCAGCCAGAGTGATGGAGGTTGGCATTGATAAGCTGTATGCTGAGACGGATCCACTAGGAAAAGCTGATAGAATCAAAGAATTACAGTTACGATTATATTATAGTTACAGGGGTGGTGTGAGTGGATTACAATTACCCAGCTCCACAAGTAATTTTGTTCGGGTTTTGAACGCAGATTGAGGATTACTAAATTATATTTCAAATGACTTATCTAGGATGAAAGGAATGGCGGTGGCAATGATGGGAGATGGAATTAATGACTCT
Protein Sequence
- />MD03G1182600
MCVLVSIDGKIAGSFAVTDPVKLEAARVISYLHSINITSIMVTGDNWATAAARVMEVGIDKLYAETDPLGKADRIKELQLRLYYSYRGGVSGLQLPSSTSNFVRVLNAD