Gene Details:
- Gene ID: HORVU.MOREX.r3.3HG0310820
- Gene Symbol: HvOS2
- Gene Name: ODDSOC2
- Genome: MorexV3_pseudomolecules_assembly
- Species: Hordeum vulgare
Functional Descriptions:
- Fine-tuning of the flowering time control in winter barley: the importance of HvOS2 and HvVRN2 in non-inductive conditions.
- The flowering promoter gene in short days, HvFT3, was only expressed after receiving induction of cold or plant age, which was associated with low transcript levels of HvVRN2 and HvOS2.
- HvOS2, an ortholog of FLC, appears as a strong candidate to mediate in the vernalization response of barley.
- Future research will be needed to ascertain the involvement of HvOS2 in the vernalization mechanism and the effect of the polymorphisms found in coding and non-coding sequences.
Function-related keywords:
Literature:
- Fine-tuning of the flowering time control in winter barley: the importance of HvOS2 and HvVRN2 in non-inductive conditions. DOI: 10.1186/s12870-019-1727-9 ; PMID: 30909882
Related News:
Gene Resources:
Orthologs:
Sequences:
cDNA Sequence
- >HORVU.MOREX.r3.3HG0310820.1
ATGGCGCGGCGCGGGCGGGTTGAGCTGCGGCGGATCGAGGACCGGACGAGCCGGCAGGTGCGCTTCTCCAAGCGCCGCGCGGGGCTCTTCAAGAAGGCCTTCGAGCTCTCGCTCCTCTGTGACGCCGAGGTCGCGCTGCTCGTCTTCTCCCCCGCCGGCAAGCTCTACGAGTACTCCTCAGCCAGGTGCATGCCGCTCCCGCTCGCCGCTCGCCTGCCCCCCGCACTTAATTTATCCCCTTGA
CDS Sequence
- >HORVU.MOREX.r3.3HG0310820.1
ATGGCGCGGCGCGGGCGGGTTGAGCTGCGGCGGATCGAGGACCGGACGAGCCGGCAGGTGCGCTTCTCCAAGCGCCGCGCGGGGCTCTTCAAGAAGGCCTTCGAGCTCTCGCTCCTCTGTGACGCCGAGGTCGCGCTGCTCGTCTTCTCCCCCGCCGGCAAGCTCTACGAGTACTCCTCAGCCAGGTGCATGCCGCTCCCGCTCGCCGCTCGCCTGCCCCCCGCACTTAATTTATCCCCTTGA
Protein Sequence
- >HORVU.MOREX.r3.3HG0310820.1.CDS1
MARRGRVELRRIEDRTSRQVRFSKRRAGLFKKAFELSLLCDAEVALLVFSPAGKLYEYSSARCMPLPLAARLPPALNLSP