Gene Details:
- Gene ID: Gh_A10G2049
- Gene Symbol: GhnsLTPsA10
- Gene Name:
- Genome: TM1_NBI
- Species: Gossypium hirsutum
Functional Descriptions:
- A locus significantly associated with Verticillium wilt (VW) resistance, and within a 145.5-kb linkage disequilibrium, two non-specific lipid transfer protein genes (named GhnsLTPsA10) were highly expressed under Verticillium pathogen stress.
- GhnsLTPsA10 played antagonistic roles in positively regulating VW and Fusarium wilt resistance and negatively mediating aphid and bollworm resistance in transgenic Arabidopsis and silenced cotton.
- The novel function of GhnsLTP and the molecular association between disease resistance and insect resistance, balanced by GhnsLTPsA10.
- GhnsLTPsA10 contributed to reactive oxygen species accumulation.
- This broadens our knowledge of the biological function of GhnsLTPsA10 in crops and provides a useful locus for genetic improvement of cotton.
Function-related keywords:
- resistance , stress , disease , disease-resistance , insect , pathogen , reactive-oxygen-species , insect-resistance , pathogen-resistance
Literature:
- Tissue-specific expression of GhnsLTPs identified via GWAS sophisticatedly coordinates disease and insect resistance by regulating metabolic flux redirection in cotton. DOI: 10.1111/tpj.15349 ; PMID: 34008265
Related News:
Gene Resources:
Sequences:
cDNA Sequence
CDS Sequence
- >Gh_A10G2049
ATGGAAACTCAAGTGAAGTACATGTGGGTTGTGGTGTTTGTTGTGAGTATGACCATTGCAGGGCTAAACGGAGTGGAAGCAACTCATGATTACTATGGTCCCTGTGGGAAACATGACATCGAGAAGGAAGCTCAGAAGCTGTCTCCATGTACATACGCTGCAAAATACTGGAGAGCTCCGGTTTCTGAGCGTTGCTGTGCTATAATAGAGAAAAAGCTCACCAATCCAGGCTGCCTCTGCGCTATTCTGCAAACTCGTACCGCATACGATGCCGGGGTGAGGCCAGAAGTTGCCGTTACCATTCCAAAACGCTGCAACATTGCTGTTCGTCCGGTCGGTCACAAGTGCGGAGGTACGTTCAATTTTGCATGCTGCAGTTTTCGTTACCTTTACTTTAGACATATAATGGTTTCATTCTGA
Protein Sequence
- >Gh_A10G2049
METQVKYMWVVVFVVSMTIAGLNGVEATHDYYGPCGKHDIEKEAQKLSPCTYAAKYWRAPVSERCCAIIEKKLTNPGCLCAILQTRTAYDAGVRPEVAVTIPKRCNIAVRPVGHKCGGTFNFACCSFRYLYFRHIMVSF