Gene Details:
- Gene ID: Gh_A11G1857
- Gene Symbol: GhCUL1
- Gene Name:
- Genome: TM1_NBI
- Species: Gossypium hirsutum
Functional Descriptions:
- GhUBP15 and GhCUL1 were identified to influence PH in further analysis. We obtained a time series of PH values for three field conditions based on remote sensing with UAV. The key genes identified in this study are of great value for the breeding of ideal plant architecture in cotton.
- Knockdown of GhUBP15 and GhCUL1 expression was associated with reduced PH in R15 VIGS plants.
- VIGS of GhUBP15 and GhCUL1 reduced PH in cotton.
Function-related keywords:
Literature:
- UAV-based time-series phenotyping reveals the genetic basis of plant height in upland cotton. DOI: 10.1111/tpj.16272 ; PMID: 37154288
Related News:
Gene Resources:
Sequences:
cDNA Sequence
CDS Sequence
- >Gh_A11G1857
TCTTTCCACTGCGGGCATGGAAAGGCTTATCTCTTTGATAAGCATGTTACTGCTGAAGGTACAGCCTTGGTTCAACAGGCAGAAGATGCTGCTTCAAATGCTCCGGGTGTGCAGGAACAGGTCTTTATAACGAAAATAATCAAGCTGCACGACAAGTATATGGCATATGTGGCCGACTGTTTTCAAAACCATACTCTCTTCCACAAGGCCCACTACCAACCCCCGCTCGCCAAACCCTCTAGTGATCACAGTTCGTTGAATCCATTAACGAACACCAGCTCGCCAGACCTACTGGCGTACACCATCTCTTGGACCTGA
Protein Sequence
- >Gh_A11G1857
SFHCGHGKAYLFDKHVTAEGTALVQQAEDAASNAPGVQEQVFITKIIKLHDKYMAYVADCFQNHTLFHKAHYQPPLAKPSSDHSSLNPLTNTSSPDLLAYTISWT