Gene Details:

  • Gene ID: Gh_D07G1901
  • Gene Symbol: GhMYB2
  • Gene Name:
  • Genome: TM1_NBI
  • Species: Gossypium hirsutum

Functional Descriptions:

  • GhMYB2, a gene with potential roles in cotton fiber cell fate determination, is a target gene of miR828 and miR858 in the generation of phasiRNAs.
  • The phasiRNAs derived from GhMYB2 were expressed in the somatic tissues, especially in anther and hypocotyl.
  • GhMYB2 loci in the cotton genome generate phasiRNAs in somatic tissues, but not in undifferentiated cells.
  • GhMYB2 encodes a MYB transcriptional factor that plays a role in plant epidermal cell fate determination. Promoter activity assay and mRNA in situ data demonstrate that GhMYB2 expression predominantly occurs in cotton seed fiber cells during the cell differentiation stage.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Orthologs:

Sequences:

cDNA Sequence
CDS Sequence
  • >Gh_D07G1901
    ATGGCAATATCTCTCCTGAGCTTATTCTTCTTATATCTTTTCTTCTATTCTCGAAATTCTTTGATGATTATTCGAGTTTTCTTGACCTTGCAAGTCCGTAAGCAAGGTAAAATTGTTCTTGACCACTTTAAGAATTTTCAAGAGACTCTGAGCATGAAATTTTCATCAAAAGTTCGAGAAAGTTCTTATCTATCTTCTATCCCTCCTGAGCTGTATCTTCTCTTGGTCTCATTTCTCTTTAACCTAGCTAGGGTTATCTTTTATCATCTGTTTCGGTTTTAA
Protein Sequence
  • >Gh_D07G1901
    MAISLLSLFFLYLFFYSRNSLMIIRVFLTLQVRKQGKIVLDHFKNFQETLSMKFSSKVRESSYLSSIPPELYLLLVSFLFNLARVIFYHLFRF