Gene Details:

  • Gene ID: Gh_A09G1166
  • Gene Symbol: GhAlaRP-A
  • Gene Name:
  • Genome: TM1_NBI
  • Species: Gossypium hirsutum

Functional Descriptions:

  • GhAlaRP is highly expressed in rapid elongating cotton fibers.
  • Downregulation of GhAlaRP suppressed the expression levels of GhAnnexin and GhEXPA in cotton fibers.
  • GhAlaRP is thus an essential component of the regulatory network including GhAnnexin and GhEXPA that contributes to cotton fiber elongation.
  • Inhibiting the expression of GhAlaRP had a negative effect on the elongation of cotton fibers.
  • GhAlaRP is highly expressed in rapid elongating cotton fibers.
  • Downregulation of GhAlaRP suppressed the expression levels of GhAnnexin and GhEXPA in cotton fibers.
  • GhAlaRP is thus an essential component of the regulatory network including GhAnnexin and GhEXPA that contributes to cotton fiber elongation.
  • Inhibiting the expression of GhAlaRP had a negative effect on the elongation of cotton fibers.

Literature:

Gene Resources:

  • NCBI ID:
  • UniProt accessions:

Orthologs:

Sequences:

cDNA Sequence
CDS Sequence
  • >Gh_A09G1166
    ATGGCTCGGATTGGGACCTCTGCAGCTCACATTGTGTTGGCAATATTTGCTGTGGCCATGTTTGTTGTGTCCGGGACCATGGCACAGGATATTGCTCCTTCTCCTGCAATGGCTACCGGAGCAGGCTCTGCTTTGCCGGTTTCCGCTGTCTTCTTATGCTCTTCCATGTTGGTCTCTTTAATTGCTCTCTTGGTGCATTGA
Protein Sequence
  • >Gh_A09G1166
    MARIGTSAAHIVLAIFAVAMFVVSGTMAQDIAPSPAMATGAGSALPVSAVFLCSSMLVSLIALLVH