Gene Details:
- Gene ID: Gh_A09G1166
- Gene Symbol: GhAlaRP-A
- Gene Name:
- Genome: TM1_NBI
- Species: Gossypium hirsutum
Functional Descriptions:
- GhAlaRP is highly expressed in rapid elongating cotton fibers.
- Downregulation of GhAlaRP suppressed the expression levels of GhAnnexin and GhEXPA in cotton fibers.
- GhAlaRP is thus an essential component of the regulatory network including GhAnnexin and GhEXPA that contributes to cotton fiber elongation.
- Inhibiting the expression of GhAlaRP had a negative effect on the elongation of cotton fibers.
- GhAlaRP is highly expressed in rapid elongating cotton fibers.
- Downregulation of GhAlaRP suppressed the expression levels of GhAnnexin and GhEXPA in cotton fibers.
- GhAlaRP is thus an essential component of the regulatory network including GhAnnexin and GhEXPA that contributes to cotton fiber elongation.
- Inhibiting the expression of GhAlaRP had a negative effect on the elongation of cotton fibers.
Function-related keywords:
Literature:
- GhAlaRP, a cotton alanine rich protein gene, involves in fiber elongation process. DOI: 10.1016/j.cj.2020.08.007
- GhAlaRP, a cotton alanine rich protein gene, involves in fiber elongation process. DOI: 10.1016/j.cj.2020.08.007
Related News:
Gene Resources:
Orthologs:
Sequences:
cDNA Sequence
CDS Sequence
- >Gh_A09G1166
ATGGCTCGGATTGGGACCTCTGCAGCTCACATTGTGTTGGCAATATTTGCTGTGGCCATGTTTGTTGTGTCCGGGACCATGGCACAGGATATTGCTCCTTCTCCTGCAATGGCTACCGGAGCAGGCTCTGCTTTGCCGGTTTCCGCTGTCTTCTTATGCTCTTCCATGTTGGTCTCTTTAATTGCTCTCTTGGTGCATTGA
Protein Sequence
- >Gh_A09G1166
MARIGTSAAHIVLAIFAVAMFVVSGTMAQDIAPSPAMATGAGSALPVSAVFLCSSMLVSLIALLVH