Gene Details:
- Gene ID: Glyma.06g284100
- Gene Symbol: GmRIC2
- Gene Name: Rhizobia-Induced CLE2
- Genome: Wm82.a4.v1
- Species: Glycine max
Functional Descriptions:
- Here, we report that microRNA172c (miR172c) activates soybean (Glycine max) Rhizobia-Induced CLE1 (GmRIC1) and GmRIC2 by removing the transcriptional repression of these genes by Nodule Number Control 1 (NNC1), leading to the activation of the AON pathway.
- These results suggest that both GmRIC1 and GmRIC2 act downstream of NNC1 and that the miR172c/NNC1 module regulates nodule number in soybean via GmRIC1 and GmRIC2.
- NNC1 knockdown resulted in dramatically higher expression levels of GmRIC1 and GmRIC2 at 5 DAI, suggesting an NNC1 inhibits the expression of both genes during nodulation.
- Given this result, we speculated that GmNINa and NNC1 antagonistically regulate GmRIC1 and GmRIC2 expression by competing for cis-element binding during nodulation.
- The GmRIC1 and GmRIC2 genes initiated expression solely in the roots at approximately 3 days after inoculation (DAI) with Nod factor-producing rhizobia, corresponding to the time point of AON, and the expression was up-regulated by cytokinins.
- The results of this study suggest that GmRIC1 and GmRIC2 are good candidates for root-derived signal Q in AON signal transduction.
Function-related keywords:
Literature:
- A GmNINa-miR172c-NNC1 Regulatory Network Coordinates the Nodulation and Autoregulation of Nodulation Pathways in Soybean DOI: 10.1016/j.molp.2019.06.002 ; PMID: 31201867
- A GmNINa-miR172c-NNC1 Regulatory Network Coordinates the Nodulation and Autoregulation of Nodulation Pathways in Soybean DOI: 10.1093/pcp/pcr091 ; PMID: 21757457
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >Glyma.06G284100.1
ATGGGAAATACAAGTGCAACCCTAGTGCCCATACTTGCCCTAATCATGTTCTCTACATTCTTCATGACTTTGCAAGCTCGTAGTCTCCATGGCCACAATCCATTATTCGCTCACAAAAAAGTTGTTGACATCCAAAACTTTCTCCACAAATCGGGTATTCACCTATCAAAGCGTGTGCGTATTCCATTTGGTGATGATCTCCCACTAGCACCTGCAGATAGACTTGCACCAGGAGGACCAGATCCTCAGCATAATGTGAGAGCTCCACCACGCAAGCCATAG
CDS Sequence
- >Glyma.06G284100.1
ATGGGAAATACAAGTGCAACCCTAGTGCCCATACTTGCCCTAATCATGTTCTCTACATTCTTCATGACTTTGCAAGCTCGTAGTCTCCATGGCCACAATCCATTATTCGCTCACAAAAAAGTTGTTGACATCCAAAACTTTCTCCACAAATCGGGTATTCACCTATCAAAGCGTGTGCGTATTCCATTTGGTGATGATCTCCCACTAGCACCTGCAGATAGACTTGCACCAGGAGGACCAGATCCTCAGCATAATGTGAGAGCTCCACCACGCAAGCCATAG
Protein Sequence
- >Glyma.06G284100.1
MGNTSATLVPILALIMFSTFFMTLQARSLHGHNPLFAHKKVVDIQNFLHKSGIHLSKRVRIPFGDDLPLAPADRLAPGGPDPQHNVRAPPRKP*