Gene Details:

Functional Descriptions:

  • Here, we report that microRNA172c (miR172c) activates soybean (Glycine max) Rhizobia-Induced CLE1 (GmRIC1) and GmRIC2 by removing the transcriptional repression of these genes by Nodule Number Control 1 (NNC1), leading to the activation of the AON pathway.
  • These results suggest that both GmRIC1 and GmRIC2 act downstream of NNC1 and that the miR172c/NNC1 module regulates nodule number in soybean via GmRIC1 and GmRIC2.
  • NNC1 knockdown resulted in dramatically higher expression levels of GmRIC1 and GmRIC2 at 5 DAI, suggesting an NNC1 inhibits the expression of both genes during nodulation.
  • Given this result, we speculated that GmNINa and NNC1 antagonistically regulate GmRIC1 and GmRIC2 expression by competing for cis-element binding during nodulation.
  • The GmRIC1 and GmRIC2 genes initiated expression solely in the roots at approximately 3 days after inoculation (DAI) with Nod factor-producing rhizobia, corresponding to the time point of AON, and the expression was up-regulated by cytokinins.
  • The results of this study suggest that GmRIC1 and GmRIC2 are good candidates for root-derived signal Q in AON signal transduction.

Literature:

Gene Resources:

Sequences:

cDNA Sequence
  • >Glyma.06G284100.1
    ATGGGAAATACAAGTGCAACCCTAGTGCCCATACTTGCCCTAATCATGTTCTCTACATTCTTCATGACTTTGCAAGCTCGTAGTCTCCATGGCCACAATCCATTATTCGCTCACAAAAAAGTTGTTGACATCCAAAACTTTCTCCACAAATCGGGTATTCACCTATCAAAGCGTGTGCGTATTCCATTTGGTGATGATCTCCCACTAGCACCTGCAGATAGACTTGCACCAGGAGGACCAGATCCTCAGCATAATGTGAGAGCTCCACCACGCAAGCCATAG
CDS Sequence
  • >Glyma.06G284100.1
    ATGGGAAATACAAGTGCAACCCTAGTGCCCATACTTGCCCTAATCATGTTCTCTACATTCTTCATGACTTTGCAAGCTCGTAGTCTCCATGGCCACAATCCATTATTCGCTCACAAAAAAGTTGTTGACATCCAAAACTTTCTCCACAAATCGGGTATTCACCTATCAAAGCGTGTGCGTATTCCATTTGGTGATGATCTCCCACTAGCACCTGCAGATAGACTTGCACCAGGAGGACCAGATCCTCAGCATAATGTGAGAGCTCCACCACGCAAGCCATAG
Protein Sequence
  • >Glyma.06G284100.1
    MGNTSATLVPILALIMFSTFFMTLQARSLHGHNPLFAHKKVVDIQNFLHKSGIHLSKRVRIPFGDDLPLAPADRLAPGGPDPQHNVRAPPRKP*