Gene Details:
- Gene ID: Csa_6G496960
- Gene Symbol: ACS1G
- Gene Name: 1-aminocyclopropane-1-carboxylate synthase
- Genome: Cucumis sativus ASM407v2
- Species: Cucumis sativus
Functional Descriptions:
- Gain-of-function of the 1-aminocyclopropane-1-carboxylate synthase gene ACS1G induces female flower development in cucumber gynoecy.
- Here, we created a set of mutants and revealed that ACS1G is responsible for gynoecy conferred by the F locus.
- The duplication resulted in ACS1G acquiring a new promoter and expression pattern; in plants carrying the F locus duplication, ACS1G is expressed early in floral bud development, where it functions with ACO2 to generate an ethylene burst.
- This early ACS1G expression bypasses the need for ACS11 to produce ethylene, thereby establishing a dominant pathway for female floral development. Based on these findings, we propose a model for how these ethylene biosynthesis genes cooperate to control unisexual flower development in cucumber.
Function-related keywords:
Literature:
- Gain-of-function of the 1-aminocyclopropane-1-carboxylate synthase gene ACS1G induces female flower development in cucumber gynoecy. DOI: 10.1093/plcell/koaa018 ; PMID: 33793793
Related News:
Gene Resources:
Sequences:
cDNA Sequence
- >Csa_6G496960
AAGAAGAAGATAGATCATCATGGGAAGAGCTCCTTGTTGTGACAAAGCCAATGTGAAAAAAGGTCCTTGGTCGCCTGAGGAAGATGCCAAACTCAAAGCTTATATTGACCAATTTGGCACCGGCGGTAACTGGATTGCCTTGCCTCAAAAAATAGGTAACTTCCAAGTTTCATTACAATATTTATAA
CDS Sequence
- >Csa_6G496960
ATGGGAAGAGCTCCTTGTTGTGACAAAGCCAATGTGAAAAAAGGTCCTTGGTCGCCTGAGGAAGATGCCAAACTCAAAGCTTATATTGACCAATTTGGCACCGGCGGTAACTGGATTGCCTTGCCTCAAAAAATAGGTAACTTCCAAGTTTCATTACAATATTTATAA
Protein Sequence
- >Csa_6G496960
MGRAPCCDKANVKKGPWSPEEDAKLKAYIDQFGTGGNWIALPQKIGNFQVSLQYL