Gene Details:
- Gene ID: BnaA07g27400D
- Gene Symbol: BnA07.IDA|BnaIDA-A07
- Gene Name: Inflorescence Deficient in Abscission7
- Genome:
- Species: Brassica napus
Functional Descriptions:
- BnC06.IDA and BnA07.IDA|BnaIDA-A07 share a highly conserved amino-acid sequence and exhibit 76.9% sequence similarity to AtIDA.
- Transcriptomic analysis revealed that BnC06.IDA and BnA07.IDA|BnaIDA-A07 were preferentially expressed in the floral abscission zone (AZ), and in other floral organs, including petals, sepals, and filaments.
- Our results suggest a role for BnC06.IDA and BnA07.IDA|BnaIDA-A07 in determining the fate of floral organ abscission.
- Demonstrate that BnA07.IDA|BnaIDA-A07 and BnC06.IDA are functionally redundant and are involved in the regulation of floral abscission in OSR.
- This suggests that BnA07.IDA|BnaIDA-A07 and BnaIDA-C06 may be involved in floral organ abscission in B. napus.
- We also generated plants overexpressing BnA07.IDA|BnaIDA-A07 (OE-BnA07.IDA|BnaIDA-A07) and found that the rate of floral organ detachment was greater than in the WT line.
- This result suggests that BnA07.IDA|BnaIDA-A07 and BnaIDA-C06 play a crucial role in silique dehiscence.
- Therefore, important agronomic traits were unaffected by the simultaneous knock out of BnA07.IDA|BnaIDA-A07 and BnaIDA-C06 genes in B. napus.
Function-related keywords:
Literature:
- Generating an oilseed rape mutant with non-abscising floral organs using CRISPR/Cas9 technology. DOI: 10.1093/plphys/kiac364 ; PMID: 35951752
- CRISPR-mediated BnaIDA editing prevents silique shattering, floral organ abscission, and spreading of Sclerotinia sclerotiorum in Brassica napus. DOI: 10.1016/j.xplc.2022.100452 ; PMID: 36127875
Related News:
Gene Resources:
Orthologs:
Sequences:
cDNA Sequence
- >BnaA07g27400D
ATGGCTCCGTGTCGTACGATGGTTCTGCTCTGTCTAGTTCTGTTTCTGGCGGCGAGTAGCTCTTCGTATGTGGCGGCTGCAAGAATTGGAGCCACCGTGGAGATGAAGAATAGGAAGAGCTTAGGGTTCAAAGACAGCCTTATTTCTGGTTACTTGCCCAAAGGCGTTCCCATTCCTCCTTCTGCCCCTTCGAAGAGACACAACTCTCTTATTGACTCTCATCCTCATTGA
CDS Sequence
- >BnaA07g27400D
ATGGCTCCGTGTCGTACGATGGTTCTGCTCTGTCTAGTTCTGTTTCTGGCGGCGAGTAGCTCTTCGTATGTGGCGGCTGCAAGAATTGGAGCCACCGTGGAGATGAAGAATAGGAAGAGCTTAGGGTTCAAAGACAGCCTTATTTCTGGTTACTTGCCCAAAGGCGTTCCCATTCCTCCTTCTGCCCCTTCGAAGAGACACAACTCTCTTATTGACTCTCATCCTCATTGA
Protein Sequence
- >BnaA07g27400D
MAPCRTMVLLCLVLFLAASSSSYVAAARIGATVEMKNRKSLGFKDSLISGYLPKGVPIPPSAPSKRHNSLIDSHPH