Information report for AT4G15910
Gene Details
|
|
Functional Descriptions
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- GO:0009414 — acts upstream of or within — response to water deprivation
- GO:0009737 — acts upstream of or within — response to abscisic acid
- GO:0009409 — involved in — response to cold
- GO:0003674 — enables — molecular_function
- GO:0009507 — located in — chloroplast
- GO:0005739 — located in — mitochondrion
- GO:0009631 — involved in — cold acclimation
- GO:0006950 — involved in — response to stress
- GO:0009737 — involved in — response to abscisic acid
Functional Keywords
Literature and News
- Abscisic acid-dependent and -independent regulation of gene expression by progressive drought in Arabidopsis thaliana. DOI: 10.1007/BF00290128 ; PMID: 7823904
- Diverse RNA viruses elicit the expression of common sets of genes in susceptible Arabidopsis thaliana plants. DOI: 10.1046/j.1365-313x.2003.01625.x ; PMID: 12535341
- Leaf vitamin C contents modulate plant defense transcripts and regulate genes that control development through hormone signaling. DOI: 10.1105/tpc.010538 ; PMID: 12671089
- Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. DOI: 10.1074/jbc.M308435200 ; PMID: 14576160
- The Arabidopsis root transcriptome by serial analysis of gene expression. Gene identification using the genome sequence. DOI: 10.1104/pp.103.030536 ; PMID: 14730065
- When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress. DOI: 10.1104/pp.103.033431 ; PMID: 15047901
- Differential mRNA translation contributes to gene regulation under non-stress and dehydration stress conditions in Arabidopsis thaliana. DOI: 10.1111/j.1365-313X.2004.02090.x ; PMID: 15144383
- Identification of cold-inducible downstream genes of the Arabidopsis DREB1A/CBF3 transcriptional factor using two microarray systems. DOI: 10.1111/j.1365-313X.2004.02100.x ; PMID: 15165189
- The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis. DOI: 10.1038/sj.emboj.7600337 ; PMID: 15282545
- Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. DOI: 10.1111/j.1365-313X.2004.02176.x ; PMID: 15341633
- Roles of the CBF2 and ZAT12 transcription factors in configuring the low temperature transcriptome of Arabidopsis. DOI: 10.1111/j.1365-313X.2004.02288.x ; PMID: 15634197
- A global survey of gene regulation during cold acclimation in Arabidopsis thaliana. DOI: 10.1371/journal.pgen.0010026 ; PMID: 16121258
- The Arabidopsis heterochromatin protein1 homolog (TERMINAL FLOWER2) silences genes within the euchromatic region but not genes positioned in heterochromatin. DOI: 10.1093/pcp/pci195 ; PMID: 16131496
- The Arabidopsis cold-responsive transcriptome and its regulation by ICE1. DOI: 10.1105/tpc.105.035568 ; PMID: 16214899
- Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis. DOI: 10.1111/j.1365-313X.2005.02584.x ; PMID: 16367961
- Monitoring expression profiles of Arabidopsis genes during cold acclimation and deacclimation using DNA microarrays. DOI: 10.1007/s10142-005-0014-z ; PMID: 16463051
- Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses. DOI: 10.1016/j.cell.2006.05.050 ; PMID: 16901781
- LEA (late embryogenesis abundant) proteins and their encoding genes in Arabidopsis thaliana. DOI: 10.1186/1471-2164-9-118 ; PMID: 18318901
- Comparative mapping of Brassica juncea and Arabidopsis thaliana using Intron Polymorphism (IP) markers: homoeologous relationships, diversification and evolution of the A, B and C Brassica genomes. DOI: 10.1186/1471-2164-9-113 ; PMID: 18315867
- Transcriptional responses of Arabidopsis thaliana plants to As (V) stress. DOI: 10.1186/1471-2229-8-87 ; PMID: 18684332
- Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. DOI: 10.1104/pp.108.126979 ; PMID: 18805951
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- The ubiquitous distribution of late embryogenesis abundant proteins across cell compartments in Arabidopsis offers tailored protection against abiotic stress. DOI: 10.1105/tpc.114.127316 ; PMID: 25005920
- AtRBP1, which encodes an RNA-binding protein containing RNA-recognition motifs, regulates root growth in Arabidopsis thaliana. DOI: 10.1016/j.plaphy.2015.04.009 ; PMID: 25913162
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
Gene Resources
- UniProt: A0A178UX68
- EMBL: CACSHJ010000095, LR881469, LUHQ01000004
- AlphaFoldDB: A0A178UX68
- EnsemblPlants: AT4G15910.1
- Gramene: AT4G15910.1
- KEGG: ath:AT4G15910
- Orthologous matrix: RVMVGKM
- ExpressionAtlas: AT4G15910
- InterPro: IPR004926
- PANTHER: PTHR33509, PTHR33509:SF34
- PROSITE: PS51257
- OrthoDB: A0A178UX68
Homologs
- Oryza sativa OsLEA9
Sequences
cDNA Sequence
- >AT4G15910.1
GTCACTTGTGGGTTTCTCGAAAACAGGCAAAAACATAAATAAAACCCCCCAAAAAAATGAATTAGCCATTTACTATTTTCACATTTCAGTTTTTAACCTTACTTTGGCAGTAAGTATGAGCAGTGGGTCCACAGTAAGGCCCATGAGCCCAAATTTCTCTGTCGTGGTCTATATAAGTGCGCCTAACCCAAACCCTAAAGTCTCTCGAAAAACCATCACCGGGGAATCTGACGGCGGCTTAGTACCGGCGGCTACTGCAAAAAGGATTGTGTTCTTCTTAGGCTTGATACTTGCCTTGGGAAGAATATAACAATCATTTTGCGGTAGCTAAAACGCTAAGCTCTATCGTCATATCTTTATCATTGATACTTATTTGATATCTAAATATCATAAAAATGGCCGCTCGTTCACTCTCCGGTGCCGTTAAATCTCTTTGCTCCGCCGCATCCGGAAGTCTGTCTTGTTCCATTGTCTTAAGGAGGAGTTACGTTGCTACATCGCAGAATGTAACAGCAGCAGGATTGAGTAAGGGAGGTTCCACCAGAGTTATGGTGGGGAAGATGGAACAGAGAGGTTTAGATCAAGAGGCAGAGTCTGCTTGGGGACCAGATCCAGTTACTGGATACTACAGACCTTCCAATCGTGCGGCTGAGATTGATCCAGCTGAGCTCAGAGAGTTGCTTTTGAAAAACAAAGCAAAGTCTTTCTGAGAATTTTGATTGGTTGGTTGACTTGGTTCCAGTGGAAGGTTGTCGTAGGCGACTATTCTGATTATGTGTGTTTATGTTTGTCTTGTATCAACTATTAAGTAAAAATAAAGATCACATTAACTAGTTAAAAATATAATATCTGTTTGGATCGACTAACACAACATCTTTAGTATAACAGTGTCTTAAATGTTTTAAGAGATAAATGGGG
CDS Sequence
- >AT4G15910.1
ATGGCCGCTCGTTCACTCTCCGGTGCCGTTAAATCTCTTTGCTCCGCCGCATCCGGAAGTCTGTCTTGTTCCATTGTCTTAAGGAGGAGTTACGTTGCTACATCGCAGAATGTAACAGCAGCAGGATTGAGTAAGGGAGGTTCCACCAGAGTTATGGTGGGGAAGATGGAACAGAGAGGTTTAGATCAAGAGGCAGAGTCTGCTTGGGGACCAGATCCAGTTACTGGATACTACAGACCTTCCAATCGTGCGGCTGAGATTGATCCAGCTGAGCTCAGAGAGTTGCTTTTGAAAAACAAAGCAAAGTCTTTCTGA
Protein Sequence
- >AT4G15910.1
MAARSLSGAVKSLCSAASGSLSCSIVLRRSYVATSQNVTAAGLSKGGSTRVMVGKMEQRGLDQEAESAWGPDPVTGYYRPSNRAAEIDPAELRELLLKNKAKSF