Information report for AT3G50260
Gene Details
|
|
Functional Descriptions
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- GO:0006355 — involved in — regulation of DNA-templated transcription
- GO:0043068 — acts upstream of or within — positive regulation of programmed cell death
- GO:0009409 — acts upstream of or within — response to cold
- GO:0000976 — enables — transcription cis-regulatory region binding
- GO:0042742 — acts upstream of or within — defense response to bacterium
- GO:0009617 — acts upstream of or within — response to bacterium
- GO:0003700 — enables — DNA-binding transcription factor activity
- GO:0005634 — located in — nucleus
Functional Keywords
- root , vascular leaf , stamen , sepal , cotyledon , hypocotyl , leaf apex , collective leaf structure
Literature and News
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis. DOI: 10.1038/sj.emboj.7600337 ; PMID: 15282545
- Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. DOI: 10.1104/pp.104.039370 ; PMID: 15235117
- The Arabidopsis cold-responsive transcriptome and its regulation by ICE1. DOI: 10.1105/tpc.105.035568 ; PMID: 16214899
- Regulation of genes associated with auxin, ethylene and ABA pathways by 2,4-dichlorophenoxyacetic acid in Arabidopsis. DOI: 10.1007/s10142-005-0012-1 ; PMID: 16317577
- Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7. DOI: 10.1111/j.1365-313X.2006.02725.x ; PMID: 16553894
- Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance. DOI: 10.1111/j.1365-313X.2006.02672.x ; PMID: 16553893
- Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana. DOI: 10.1007/s10265-006-0287-x ; PMID: 16820983
- Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression. DOI: 10.1186/gb-2007-8-4-r49 ; PMID: 17408486
- Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. DOI: 10.1094/MPMI-20-8-0900 ; PMID: 17722694
- Genome-wide interacting effects of sucrose and herbicide-mediated stress in Arabidopsis thaliana: novel insights into atrazine toxicity and sucrose-induced tolerance. DOI: 10.1186/1471-2164-8-450 ; PMID: 18053238
- Functional redundancy and new roles for genes of the autonomous floral-promotion pathway. DOI: 10.1104/pp.108.118927 ; PMID: 18408043
- DEAR1, a transcriptional repressor of DREB protein that mediates plant defense and freezing stress responses in Arabidopsis. DOI: 10.1007/s10265-009-0252-6 ; PMID: 19618250
- Iron-dependent modifications of the flower transcriptome, proteome, metabolome, and hormonal content in an Arabidopsis ferritin mutant. DOI: 10.1093/jxb/ert112 ; PMID: 23682113
- Transcriptional dynamics of two seed compartments with opposing roles in Arabidopsis seed germination. DOI: 10.1104/pp.113.223511 ; PMID: 23858430
- Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. DOI: 10.1186/1471-2229-13-229 ; PMID: 24377444
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Combinatorial signal integration by APETALA2/Ethylene Response Factor (ERF)-transcription factors and the involvement of AP2-2 in starvation response. DOI: 10.3390/ijms13055933 ; PMID: 22754341
- Transcriptional regulation of nitrogen-associated metabolism and growth. DOI: 10.1038/s41586-018-0656-3 ; PMID: 30356219
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. DOI: 10.1093/molbev/msj051 ; PMID: 16280546
- Genome-wide analysis of the ERF gene family in Arabidopsis and rice. DOI: 10.1104/pp.105.073783 ; PMID: 16407444
- Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. DOI: 10.1094/MPMI-20-8-0900 ; PMID: 17722694
- Cell identity mediates the response of Arabidopsis roots to abiotic stress. DOI: 10.1126/science.1153795 ; PMID: 18436742
Gene Resources
- UniProt: A0A178VN80
- EMBL: CACSHJ010000089, LR881468, LUHQ01000003
- AlphaFoldDB: A0A178VN80
- EnsemblPlants: AT3G50260.1
- Gramene: AT3G50260.1
- KEGG: ath:AT3G50260
- Orthologous matrix: ENSDCDW
- ExpressionAtlas: AT3G50260
- InterPro: IPR001471, IPR016177, IPR036955
- PANTHER: PTHR31729, PTHR31729:SF6
- SUPFAM: SSF54171
- PROSITE: PS51032
- Gene3D: 3.30.730.10
- OrthoDB: A0A178VN80
- SWISS-MODEL: A0A178VN80
- Conserved Domain Database: cd00018
Homologs
- Brassica napus GSBRNA2T00045877001, GSBRNA2T00002000001, GSBRNA2T00070447001, GSBRNA2T00112431001, GSBRNA2T00134881001, GSBRNA2T00005705001
- Brassica oleracea XP_013600705.1
- Brassica rapa XP_009115697.1
- Raphanus raphanistrum RrC3785_p2
Sequences
cDNA Sequence
- >AT3G50260.1
TCTACCTACAACTGCAACCTCGGTCTCTTTCTCTCTTCACATATATAAGAGAGTCCCTTGATCAAGAAACCAGATAATTTCCCCAAACACAATTCTAAAGTCCTCCTCTCGGAAAGTAAGAGACTCAACTTCCGAGCCGCCATGGACGCCGGAGTAGCAGTAAAAGCTGACGTGGCAGTCAAAATGAAGAGAGAAAGACCATTCAAAGGGATCAGAATGAGAAAATGGGGGAAATGGGTTGCGGAGATTCGAGAACCCAACAAGCGTTCAAGACTTTGGCTCGGCTCTTACTCTACTCCCGAAGCGGCGGCGCGTGCATACGACACGGCTGTCTTTTACCTCAGAGGACCAACTGCTACGCTCAACTTCCCGGAGCTTCTGCCGTGTACCTCCGCCGAGGATATGTCAGCGGCAACGATCAGGAAAAAGGCGACGGAGGTGGGAGCTCAAGTAGATGCGATAGGGGCGACGGTGGTGCAGAACAACAAACGCCGCCGCGTTTTTAGTCAAAAGCGTGACTTTGGCGGCGGGTTATTAGAGCTTGTTGACTTGAACAAGTTACCTGACCCGGAAAATCTCGATGATGATTTGGTGGGAAAATAGACTGAAAAATAATAATAAAATATCTTACAATGGTGGCTGTAGCTATCGTACGCGGAATGCTTGGGCTTGTGTTATATGACTACGTGGTTACGGAAAGATTCCTCTGTTTCGTCATTGTATTAAAATTTAATCCCACAAGTCAAACATACTGTACATTATTCTTAATTTAGTATTTTCTTATTAATATCTATCATTTGTTTGGTGAACACCAGAATATTAGACTATTAATGTAACGAGTTTTTAATATTTCGATCATAATAACACCAAGCTAGTTAAAGGTTAATATCTTGTTACGAAGTCTTGAGTAAGTTCAATTGTCATATATATGTAACGGAAGAGGTTCGTTCGGGTCCCAAGTGAAGTGGA
CDS Sequence
- >AT3G50260.1
ATGGACGCCGGAGTAGCAGTAAAAGCTGACGTGGCAGTCAAAATGAAGAGAGAAAGACCATTCAAAGGGATCAGAATGAGAAAATGGGGGAAATGGGTTGCGGAGATTCGAGAACCCAACAAGCGTTCAAGACTTTGGCTCGGCTCTTACTCTACTCCCGAAGCGGCGGCGCGTGCATACGACACGGCTGTCTTTTACCTCAGAGGACCAACTGCTACGCTCAACTTCCCGGAGCTTCTGCCGTGTACCTCCGCCGAGGATATGTCAGCGGCAACGATCAGGAAAAAGGCGACGGAGGTGGGAGCTCAAGTAGATGCGATAGGGGCGACGGTGGTGCAGAACAACAAACGCCGCCGCGTTTTTAGTCAAAAGCGTGACTTTGGCGGCGGGTTATTAGAGCTTGTTGACTTGAACAAGTTACCTGACCCGGAAAATCTCGATGATGATTTGGTGGGAAAATAG
Protein Sequence
- >AT3G50260.1
MDAGVAVKADVAVKMKRERPFKGIRMRKWGKWVAEIREPNKRSRLWLGSYSTPEAAARAYDTAVFYLRGPTATLNFPELLPCTSAEDMSAATIRKKATEVGAQVDAIGATVVQNNKRRRVFSQKRDFGGGLLELVDLNKLPDPENLDDDLVGK