Information report for AT3G27850
Gene Details
|
|
Functional Descriptions
Functional Keywords
Literature and News
- Central functions of the lumenal and peripheral thylakoid proteome of Arabidopsis determined by experimentation and genome-wide prediction. DOI: 10.1105/tpc.010304 ; PMID: 11826309
- The Arabidopsis ppi1 mutant is specifically defective in the expression, chloroplast import, and accumulation of photosynthetic proteins. DOI: 10.1105/tpc.012955 ; PMID: 12897258
- Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. DOI: 10.1074/jbc.M308435200 ; PMID: 14576160
- In-depth analysis of the thylakoid membrane proteome of Arabidopsis thaliana chloroplasts: new proteins, new functions, and a plastid proteome database. DOI: 10.1105/tpc.017814 ; PMID: 14729914
- Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors. DOI: 10.1105/tpc.104.023309 ; PMID: 15273297
- New functions of the thylakoid membrane proteome of Arabidopsis thaliana revealed by a simple, fast, and versatile fractionation strategy. DOI: 10.1074/jbc.M406763200 ; PMID: 15322131
- Post-translational modifications, but not transcriptional regulation, of major chloroplast RNA-binding proteins are related to Arabidopsis seedling development. DOI: 10.1002/pmic.200500657 ; PMID: 16548064
- Modifications to the Arabidopsis defense proteome occur prior to significant transcriptional change in response to inoculation with Pseudomonas syringae. DOI: 10.1104/pp.106.086231 ; PMID: 17028151
- Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA. DOI: 10.1007/s11103-007-9241-0 ; PMID: 17885809
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Quantitative proteomics of a chloroplast SRP54 sorting mutant and its genetic interactions with CLPC1 in Arabidopsis. DOI: 10.1104/pp.108.124545 ; PMID: 18633119
- Proteome and metabolome profiling of cytokinin action in Arabidopsis identifying and up-regulation. DOI: 10.1093/jxb/ert227 ; PMID: 24064926
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Discovering the RNA-Binding Proteome of Plant Leaves with an Improved RNA Interactome Capture Method. DOI: 10.3390/biom10040661 ; PMID: 32344669
- An updated nomenclature for plant ribosomal protein genes. DOI: 10.1093/plcell/koac333 ; PMID: 36423343
- Central functions of the lumenal and peripheral thylakoid proteome of Arabidopsis determined by experimentation and genome-wide prediction. DOI: 10.1105/tpc.010304 ; PMID: 11826309
- In-depth analysis of the thylakoid membrane proteome of Arabidopsis thaliana chloroplasts: new proteins, new functions, and a plastid proteome database. DOI: 10.1105/tpc.017814 ; PMID: 14729914
- The Arabidopsis thaliana chloroplast proteome reveals pathway abundance and novel protein functions. DOI: 10.1016/j.cub.2004.02.039 ; PMID: 15028209
- New functions of the thylakoid membrane proteome of Arabidopsis thaliana revealed by a simple, fast, and versatile fractionation strategy. DOI: 10.1074/jbc.M406763200 ; PMID: 15322131
- High light response of the thylakoid proteome in arabidopsis wild type and the ascorbate-deficient mutant vtc2-2. A comparative proteomics study. DOI: 10.1104/pp.106.080150 ; PMID: 16648217
- Modifications to the Arabidopsis defense proteome occur prior to significant transcriptional change in response to inoculation with Pseudomonas syringae. DOI: 10.1104/pp.106.086231 ; PMID: 17028151
- Quantitative proteomics of a chloroplast SRP54 sorting mutant and its genetic interactions with CLPC1 in Arabidopsis. DOI: 10.1104/pp.108.124545 ; PMID: 18633119
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Gene Resources
- UniProt: A0A5S9XGA9
- EMBL: CACRSJ010000106, CACSHJ010000089, LR881468
- AlphaFoldDB: A0A5S9XGA9
- EnsemblPlants: AT3G27850.1
- Gramene: AT3G27850.1
- KEGG: ath:AT3G27850
- ExpressionAtlas: AT3G27850
- InterPro: IPR000206, IPR008932, IPR013823
- PANTHER: PTHR45987, PTHR45987:SF26
- SUPFAM: SSF48300, SSF54736
- Gene3D: 1.20.5.710, 3.30.1390.10
- OrthoDB: A0A5S9XGA9
- SWISS-MODEL: A0A5S9XGA9
- Conserved Domain Database: cd00387
Homologs
- Oryza sativa PRPL12
Sequences
cDNA Sequence
- >AT3G27850.1
AAAATACCCCTTATCTTTTGTTTTTTTATCCTCCTCATCTTCTACAAACACACTCACAGAGACACACAAAACAAATCCCAAAGCTTCAGAGGAAGAAGAAGAAGAGAGTGAGAAACAATGGCGTCGACGACTCTCTCAATCGCAACAACAATCCGTTCCTCTTCTCCTCTCACTTCCGCTTCCACTCATCACTTCCTTTCCAAACCCACCGCAATCGAATTCCCATTTCGTCTCAGCTCTTCTTCTAGCCACCGTGCAATCAACCTCCGTCCTATCTCCGCCGTCGAAGCTCCGGAGAAAATCGAGAAAATCGGATCCGAAATCTCCTCCTTAACCCTCGAAGAAGCTCGTATCCTCGTCGACTATCTCCAAGACAAATTCGGTGTCTCCCCACTCTCCTTAGCCCCCGCAGCAGCGGCCGTTGCAGCTCCAGCCGACGGTGGCGCGGCGGCTGTAGTGGAGGAGCAAACAGAGTTCGATGTGGTTATCAATGAAGTTCCGAGTAGTTCTCGTATTGCAGTAATTAAAGCTGTTAGGGCTTTGACTAGCTTGGCGTTGAAGGAAGCTAAGGAGCTAATCGAAGGATTACCAAAGAAGTTTAAAGAAGGTATCACTAAAGATGAAGCTGAAGAAGCTAAGAAGACTCTTGAAGAAGCTGGTGCTAAAGTCTCCATTGCTTAAGTTTCTTCAACAATCGGAAAAAAAAAAATGTGATATTTTCGGAATTTATGAGTCTTTTTGTTGTTTAGTATAGTTTGTGTTTGAGTTATTGATTCAGCTTTTGAGAAATTGTTGTACTTTGAATCAATTTGGTTTCGTATTACAGTTTTAGTCTTCAACAAGTTCTTCCTCTAGATGCACATAACCTGTTTGTTGAAATGCCTAGCTCAAAAAACACACAAAACAGAATAAACTTGCTTTTGCATAAAAATCTGATATATCTTTATAAACTTGCTTTG
CDS Sequence
- >AT3G27850.1
ATGGCGTCGACGACTCTCTCAATCGCAACAACAATCCGTTCCTCTTCTCCTCTCACTTCCGCTTCCACTCATCACTTCCTTTCCAAACCCACCGCAATCGAATTCCCATTTCGTCTCAGCTCTTCTTCTAGCCACCGTGCAATCAACCTCCGTCCTATCTCCGCCGTCGAAGCTCCGGAGAAAATCGAGAAAATCGGATCCGAAATCTCCTCCTTAACCCTCGAAGAAGCTCGTATCCTCGTCGACTATCTCCAAGACAAATTCGGTGTCTCCCCACTCTCCTTAGCCCCCGCAGCAGCGGCCGTTGCAGCTCCAGCCGACGGTGGCGCGGCGGCTGTAGTGGAGGAGCAAACAGAGTTCGATGTGGTTATCAATGAAGTTCCGAGTAGTTCTCGTATTGCAGTAATTAAAGCTGTTAGGGCTTTGACTAGCTTGGCGTTGAAGGAAGCTAAGGAGCTAATCGAAGGATTACCAAAGAAGTTTAAAGAAGGTATCACTAAAGATGAAGCTGAAGAAGCTAAGAAGACTCTTGAAGAAGCTGGTGCTAAAGTCTCCATTGCTTAA
Protein Sequence
- >AT3G27850.1
MASTTLSIATTIRSSSPLTSASTHHFLSKPTAIEFPFRLSSSSSHRAINLRPISAVEAPEKIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEFDVVINEVPSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEEAGAKVSIA