Gene Details:
- Gene ID: AT3G26790
- Gene Symbol: FUS3
- Gene Name: FUSCA3
- Description: AP2/B3-like transcriptional factor family protein;(source:Araport11)
- TAIR Accession: locus:2088439
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0005360 — aleurone layer — capa de aleurona (Spanish, exact), fruit aleurone layer (exact), 糊粉粒、アリューロン層 (Japanese, exact)
- PO:0006210 — protoderm — portion of protoderm tissue (exact), protodermis (Spanish, exact), 前表皮、原表皮 (Japanese, exact), dermatogen cell (related)
- PO:0020108 — suspensor — suspensor (Spanish, exact), 胚柄 (Japanese, exact)
- PO:0020031 — radicle — radícula (Spanish, exact), 幼根 (Japanese, exact)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0000011 — cultured somatic plant embryo — embrión somático cultivado (Spanish, exact), 培養植物体細胞不定胚 (Japanese, exact), cultured somatic embryo (broad)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
Gene Ontology:
- GO:0010228 — involved in — vegetative to reproductive phase transition of meristem
- GO:0009793 — acts upstream of or within — embryo development ending in seed dormancy
- GO:0010373 — involved in — negative regulation of gibberellin biosynthetic process
- GO:0099402 — involved in — plant organ development
- GO:0010262 — acts upstream of or within — somatic embryogenesis
- GO:0010373 — acts upstream of or within — negative regulation of gibberellin biosynthetic process
- GO:0005634 — located in — nucleus
- GO:0009789 — involved in — positive regulation of abscisic acid-activated signaling pathway
- GO:0019900 — enables — kinase binding
- GO:0045995 — involved in — regulation of embryonic development
- GO:0003677 — enables — DNA binding
- GO:0008284 — involved in — positive regulation of cell population proliferation
- GO:0003700 — enables — DNA-binding transcription factor activity
- GO:0010116 — acts upstream of or within — positive regulation of abscisic acid biosynthetic process
- GO:0009733 — acts upstream of or within — response to auxin
Function-related keywords:
- aleurone layer , protoderm , suspensor , radicle , vascular leaf , stamen , flower , collective leaf structure , cultured somatic plant embryo , plant embryo
Literature:
- Changes in gene expression in the leafy cotyledon1 (lec1) and fusca3 (fus3) mutants of Arabidopsis thaliana L. DOI: 10.1093/jexbot/51.347.995 ; PMID: 10948227
- The expression of small heat shock proteins in seeds responds to discrete developmental signals and suggests a general protective role in desiccation tolerance. DOI: 10.1104/pp.122.4.1099 ; PMID: 10759505
- Interactions of the developmental regulator ABI3 with proteins identified from developing Arabidopsis seeds. DOI: 10.1046/j.1365-313x.2000.00663.x ; PMID: 10743655
- Seed maturation: genetic programmes and control signals. DOI: 10.1016/s1369-5266(99)80007-7 ; PMID: 10047566
- Ectopic expression of a novel MYB gene modifies the architecture of the Arabidopsis inflorescence. DOI: 10.1046/j.1365-313x.1998.00072.x ; PMID: 9681014
- Two novel MYB homologues with changed expression in late embryogenesis-defective Arabidopsis mutants. DOI: 10.1023/a:1006011002499 ; PMID: 9678577
- The ABSCISIC ACID-INSENSITIVE3, FUSCA3, and LEAFY COTYLEDON1 loci act in concert to control multiple aspects of Arabidopsis seed development. DOI: 10.1105/tpc.9.8.1265 ; PMID: 9286105
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Leafy Cotyledon Mutants of Arabidopsis. DOI: 10.1105/tpc.6.8.1049 ; PMID: 12244265
- Regulatory networks in seeds integrating developmental, abscisic acid, sugar, and light signaling. DOI: 10.1104/pp.011916 ; PMID: 12529517
- Coordinate repression of regulators of embryonic identity by PICKLE during germination in Arabidopsis. DOI: 10.1046/j.1365-313x.2003.01783.x ; PMID: 12834400
- Regulation of storage protein gene expression in Arabidopsis. DOI: 10.1242/dev.00814 ; PMID: 14597573
- LEC1, FUS3, ABI3 and Em expression reveals no correlation with dormancy in Arabidopsis. DOI: 10.1093/jxb/erh014 ; PMID: 14676287
- LEAFY COTYLEDON1 controls seed storage protein genes through its regulation of FUSCA3 and ABSCISIC ACID INSENSITIVE3. DOI: 10.1093/pcp/pci048 ; PMID: 15695450
- Analysis of a sugar response mutant of Arabidopsis identified a novel B3 domain protein that functions as an active transcriptional repressor. DOI: 10.1104/pp.104.057752 ; PMID: 15894743
- Abscisic acid biosynthesis and catabolism. DOI: 10.1146/annurev.arplant.56.032604.144046 ; PMID: 15862093
- Leafy cotyledon genes are essential for induction of somatic embryogenesis of Arabidopsis. DOI: 10.1007/s00425-005-0041-y ; PMID: 16034595
- LEAFY COTYLEDON 2 activation is sufficient to trigger the accumulation of oil and seed specific mRNAs in Arabidopsis leaves. DOI: 10.1016/j.febslet.2005.07.037 ; PMID: 16107256
- A network of local and redundant gene regulation governs Arabidopsis seed maturation. DOI: 10.1105/tpc.105.039925 ; PMID: 16731585
- Repression of the LEAFY COTYLEDON 1/B3 regulatory network in plant embryo development by VP1/ABSCISIC ACID INSENSITIVE 3-LIKE B3 genes. DOI: 10.1104/pp.106.092320 ; PMID: 17158584
- Developmental control of Arabidopsis seed oil biosynthesis. DOI: 10.1007/s00425-007-0524-0 ; PMID: 17522888
- PvALF and FUS3 activate expression from the phaseolin promoter by different mechanisms. DOI: 10.1007/s11103-007-9265-5 ; PMID: 18038114
- The Arabidopsis histone deacetylases HDA6 and HDA19 contribute to the repression of embryonic properties after germination. DOI: 10.1104/pp.107.111674 ; PMID: 18024558
- Arabidopsis LEAFY COTYLEDON2 induces maturation traits and auxin activity: Implications for somatic embryogenesis. DOI: 10.1073/pnas.0712364105 ; PMID: 18287041
- Inventory, evolution and expression profiling diversity of the LEA (late embryogenesis abundant) protein gene family in Arabidopsis thaliana. DOI: 10.1007/s11103-008-9304-x ; PMID: 18265943
- Deciphering gene regulatory networks that control seed development and maturation in Arabidopsis. DOI: 10.1111/j.1365-313X.2008.03461.x ; PMID: 18476867
- A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis. DOI: 10.1104/pp.109.136531 ; PMID: 19261733
- Global identification of targets of the Arabidopsis MADS domain protein AGAMOUS-Like15. DOI: 10.1105/tpc.109.068890 ; PMID: 19767455
- Global analysis of gene activity during Arabidopsis seed development and identification of seed-specific transcription factors. DOI: 10.1073/pnas.1003530107 ; PMID: 20385809
- Overexpression of AtCSP4 affects late stages of embryo development in Arabidopsis. DOI: 10.1093/jxb/erq400 ; PMID: 21282328
- MicroRNAs regulate the timing of embryo maturation in Arabidopsis. DOI: 10.1104/pp.110.171355 ; PMID: 21330492
- Synergistic repression of the embryonic programme by SET DOMAIN GROUP 8 and EMBRYONIC FLOWER 2 in Arabidopsis seedlings. DOI: 10.1093/jxb/err383 ; PMID: 22162868
- ASIL1 is required for proper timing of seed filling in Arabidopsis. DOI: 10.4161/psb.6.12.18709 ; PMID: 22231199
- The embryonic leaf identity gene FUSCA3 regulates vegetative phase transitions by negatively modulating ethylene-regulated gene expression in Arabidopsis. DOI: 10.1186/1741-7007-10-8 ; PMID: 22348746
- A novel HSI2 mutation in Arabidopsis affects the PHD-like domain and leads to derepression of seed-specific gene expression. DOI: 10.1007/s00425-012-1630-1 ; PMID: 22476218
- Toward the identification and regulation of the Arabidopsis thaliana ABI3 regulon. DOI: 10.1093/nar/gks594 ; PMID: 22730287
- Identification of direct targets of FUSCA3, a key regulator of Arabidopsis seed development. DOI: 10.1104/pp.112.212282 ; PMID: 23314941
- Acyl-lipid metabolism. DOI: 10.1199/tab.0161 ; PMID: 23505340
- and AtBMI1-mediated H2Aub initiate the switch from embryonic to postgerminative growth in Arabidopsis. DOI: 10.1016/j.cub.2013.05.050 ; PMID: 23810531
- Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression. DOI: 10.1104/pp.113.220988 ; PMID: 24043445
- TRANSPARENT TESTA2 regulates embryonic fatty acid biosynthesis by targeting FUSCA3 during the early developmental stage of Arabidopsis seeds. DOI: 10.1111/tpj.12426 ; PMID: 24397827
- Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues. DOI: 10.1016/j.fob.2013.11.003 ; PMID: 24363987
- TRANSPARENT TESTA8 Inhibits Seed Fatty Acid Accumulation by Targeting Several Seed Development Regulators in Arabidopsis. DOI: 10.1104/pp.114.235507 ; PMID: 24722549
- Seed maturation regulators are related to the control of seed dormancy in wheat (Triticum aestivum L.). DOI: 10.1371/journal.pone.0107618 ; PMID: 25211528
- Cell-by-cell developmental transition from embryo to post-germination phase revealed by heterochronic gene expression and ER-body formation in Arabidopsis leafy cotyledon mutants. DOI: 10.1093/pcp/pcu139 ; PMID: 25282558
- Chromodomain, Helicase and DNA-binding CHD1 protein, CHR5, are involved in establishing active chromatin state of seed maturation genes. DOI: 10.1111/pbi.12315 ; PMID: 25581843
- Complementation of Seed Maturation Phenotypes by Ectopic Expression of ABSCISIC ACID INSENSITIVE3, FUSCA3 and LEAFY COTYLEDON2 in Arabidopsis. DOI: 10.1093/pcp/pcv049 ; PMID: 25840088
- Deciphering the Molecular Mechanisms Underpinning the Transcriptional Control of Gene Expression by Master Transcriptional Regulators in Arabidopsis Seed. DOI: 10.1104/pp.16.00034 ; PMID: 27208266
- FUSCA3 activates triacylglycerol accumulation in Arabidopsis seedlings and tobacco BY2 cells. DOI: 10.1111/tpj.13233 ; PMID: 27288837
- Deciphering and modifying LAFL transcriptional regulatory network in seed for improving yield and quality of storage compounds. DOI: 10.1016/j.plantsci.2016.06.013 ; PMID: 27457996
- FUSCA3 interacting with LEAFY COTYLEDON2 controls lateral root formation through regulating YUCCA4 gene expression in Arabidopsis thaliana. DOI: 10.1111/nph.14313 ; PMID: 27878992
- Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program. DOI: 10.3389/fpls.2017.00439 ; PMID: 28421087
- The BABY BOOM Transcription Factor Activates the LEC1-ABI3-FUS3-LEC2 Network to Induce Somatic Embryogenesis. DOI: 10.1104/pp.17.00232 ; PMID: 28830937
- WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions. DOI: 10.1038/s41598-017-14695-0 ; PMID: 29079824
- Arabidopsis plants exposed to dioxin result in a WRINKLED seed phenotype due to 20S proteasomal degradation of WRI1. DOI: 10.1093/jxb/ery027 ; PMID: 29394403
- HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis. DOI: 10.1105/tpc.17.00655 ; PMID: 29475938
- The onset of embryo maturation in Arabidopsis is determined by its developmental stage and does not depend on endosperm cellularization. DOI: 10.1111/tpj.14324 ; PMID: 30900325
- Embryonic resetting of the parental vernalized state by two B3 domain transcription factors in Arabidopsis. DOI: 10.1038/s41477-019-0402-3 ; PMID: 30962525
- Basic LEUCINE ZIPPER TRANSCRIPTION FACTOR67 Transactivates DELAY OF GERMINATION1 to Establish Primary Seed Dormancy in Arabidopsis. DOI: 10.1105/tpc.18.00892 ; PMID: 30962396
- Genome-wide identification of EMBRYO-DEFECTIVE (EMB) genes required for growth and development in Arabidopsis. DOI: 10.1111/nph.16071 ; PMID: 31334862
- Spatiotemporal Restriction of FUSCA3 Expression by Class I BPCs Promotes Ovule Development and Coordinates Embryo and Endosperm Growth. DOI: 10.1105/tpc.19.00764 ; PMID: 32265266
- Direct and indirect targets of the arabidopsis seed transcription factor ABSCISIC ACID INSENSITIVE3. DOI: 10.1111/tpj.14854 ; PMID: 32445409
- The effect of AINTEGUMENTA-LIKE 7 over-expression on seed fatty acid biosynthesis, storage oil accumulation and the transcriptome in Arabidopsis thaliana. DOI: 10.1007/s00299-021-02715-3 ; PMID: 34215912
- Transcriptional regulation of plant seed development. DOI: 10.1111/ppl.13548 ; PMID: 34480800
- Insights into the Histone Acetylation-Mediated Regulation of the Transcription Factor Genes That Control the Embryogenic Transition in the Somatic Cells of Arabidopsis. DOI: 10.3390/cells11050863 ; PMID: 35269485
- Transcriptional control of Arabidopsis seed development. DOI: 10.1007/s00425-022-03870-x ; PMID: 35318532
- B3 Transcription Factors Determine Iron Distribution and FERRITIN Gene Expression in Embryo but Do Not Control Total Seed Iron Content. DOI: 10.3389/fpls.2022.870078 ; PMID: 35599858
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Two B3 domain transcriptional repressors prevent sugar-inducible expression of seed maturation genes in Arabidopsis seedlings. DOI: 10.1073/pnas.0607940104 ; PMID: 17267611
- Deciphering gene regulatory networks that control seed development and maturation in Arabidopsis. DOI: 10.1111/j.1365-313X.2008.03461.x ; PMID: 18476867
Sequences:
cDNA Sequence
- >AT3G26790.1
CTCTTGGTTCTAAACTTTAACCTAACCTAATCTCTAAACTATGGTTGAGTGTTAGTTTAGTGGCATTAGATCTTGTTGCGTTACTATCATCATAATAATCTTATCAAGATTTAGAAAATCTTAATCTTCCAAAACCCTAGATTCATGAATGTAGGTTATACAAATGTCACTTCCTTACCATAAATAGTAAAACAAAAATCATTAAAAACCAATGGTAAACCCAAATCTCTGATTGCCCAGCGTCCATTTTAAGCCTCTGTTTCGATCTGCACAACACACATACACACAACACAACACAAACCACAGTCTCTCTTTCTCTCTCTATCTATCTTCTCTTTCTCTCTCTATCTCTATCACTGAAACCCAAAGAGATCCACCATTTGTTCTTTTTTCCTTCACACAGAGAACTGTTTTCTTCCACACTTCCTTTTTACTAGGCAGTGTTAACCAATTGAGAGAGAAAAATGATGGTTGATGAAAATGTGGAAACCAAGGCCTCTACTTTAGTGGCAAGTGTTGATCATGGGTTTGGATCCGGGTCGGGTCATGATCATCATGGGTTATCGGCGTCTGTGCCTCTTCTTGGTGTTAACTGGAAGAAGAGAAGGATGCCTAGACAGAGACGATCTTCTTCTTCCTTTAACCTTCTCTCTTTCCCTCCTCCTATGCCTCCTATTTCCCACGTGCCAACTCCTCTCCCCGCACGTAAAATTGACCCAAGAAAGCTAAGATTCCTCTTCCAAAAGGAACTCAAGAACAGTGACGTCAGCTCTCTCCGACGTATGATACTCCCGAAGAAAGCCGCGGAGGCTCACTTGCCGGCACTTGAATGCAAGGAAGGGATTCCTATAAGAATGGAAGATTTGGACGGTTTTCACGTTTGGACCTTCAAGTATAGGTACTGGCCAAACAACAATAGCAGAATGTACGTGCTAGAAAACACAGGCGATTTTGTGAATGCTCATGGTCTGCAGCTAGGTGACTTCATCATGGTTTACCAAGATCTCTACTCAAACAATTACGTTATACAAGCAAGAAAAGCATCGGAAGAAGAAGAAGTAGACGTAATCAATCTTGAAGAAGACGACGTTTACACAAACTTAACAAGGATCGAAAACACTGTGGTTAACGATCTTCTCCTCCAAGATTTTAATCATCACAACAACAACAACAACAACAACAGCAACAGCAACAGCAACAAATGTTCTTACTATTATCCAGTCATAGATGATGTCACCACAAACACAGAGTCTTTTGTCTACGACACGACGGCTCTTACCTCCAACGATACTCCTCTCGATTTTTTGGGTGGACATACGACGACTACTAATAATTATTACTCCAAGTTCGGAACATTCGATGGTTTGGGCTCCGTTGAGAATATCTCTCTCGATGACTTCTACTAGATAATCAATCGATGGGCTCATGGTATTCTTGATGGTGATCAGCTATTTAATATCCTTATAATATATATAAGAATTAAATGCAATTTGCATATATATTATCAAGTGTTGAATATAACATTACAGTTTATATGAAAATCATAGCTAGATGTGAGTCATGAAGGTGTGTTGTATTTGATGAATAAATGTTATTTAGTGTT
CDS Sequence
- >AT3G26790.1
ATGATGGTTGATGAAAATGTGGAAACCAAGGCCTCTACTTTAGTGGCAAGTGTTGATCATGGGTTTGGATCCGGGTCGGGTCATGATCATCATGGGTTATCGGCGTCTGTGCCTCTTCTTGGTGTTAACTGGAAGAAGAGAAGGATGCCTAGACAGAGACGATCTTCTTCTTCCTTTAACCTTCTCTCTTTCCCTCCTCCTATGCCTCCTATTTCCCACGTGCCAACTCCTCTCCCCGCACGTAAAATTGACCCAAGAAAGCTAAGATTCCTCTTCCAAAAGGAACTCAAGAACAGTGACGTCAGCTCTCTCCGACGTATGATACTCCCGAAGAAAGCCGCGGAGGCTCACTTGCCGGCACTTGAATGCAAGGAAGGGATTCCTATAAGAATGGAAGATTTGGACGGTTTTCACGTTTGGACCTTCAAGTATAGGTACTGGCCAAACAACAATAGCAGAATGTACGTGCTAGAAAACACAGGCGATTTTGTGAATGCTCATGGTCTGCAGCTAGGTGACTTCATCATGGTTTACCAAGATCTCTACTCAAACAATTACGTTATACAAGCAAGAAAAGCATCGGAAGAAGAAGAAGTAGACGTAATCAATCTTGAAGAAGACGACGTTTACACAAACTTAACAAGGATCGAAAACACTGTGGTTAACGATCTTCTCCTCCAAGATTTTAATCATCACAACAACAACAACAACAACAACAGCAACAGCAACAGCAACAAATGTTCTTACTATTATCCAGTCATAGATGATGTCACCACAAACACAGAGTCTTTTGTCTACGACACGACGGCTCTTACCTCCAACGATACTCCTCTCGATTTTTTGGGTGGACATACGACGACTACTAATAATTATTACTCCAAGTTCGGAACATTCGATGGTTTGGGCTCCGTTGAGAATATCTCTCTCGATGACTTCTACTAG
Protein Sequence
- >AT3G26790.1
MMVDENVETKASTLVASVDHGFGSGSGHDHHGLSASVPLLGVNWKKRRMPRQRRSSSSFNLLSFPPPMPPISHVPTPLPARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKASEEEEVDVINLEEDDVYTNLTRIENTVVNDLLLQDFNHHNNNNNNNSNSNSNKCSYYYPVIDDVTTNTESFVYDTTALTSNDTPLDFLGGHTTTTNNYYSKFGTFDGLGSVENISLDDFY