Information report for AT3G23230
Gene Details
|
|
Functional Descriptions
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
Functional Keywords
- shoot axis apex , root , vascular leaf , petiole , hypocotyl
Literature and News
- The AP2/EREBP family of plant transcription factors. DOI: 10.1515/bchm.1998.379.6.633 ; PMID: 9687012
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. DOI: 10.1074/jbc.M308435200 ; PMID: 14576160
- Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes. DOI: 10.1104/pp.104.042176 ; PMID: 15208423
- and activator-type ethylene response factors functioning in jasmonate signaling and disease resistance identified via a genome-wide screen of Arabidopsis transcription factor gene expression. DOI: 10.1104/pp.105.068544 ; PMID: 16183832
- Genome-wide analysis of hydrogen peroxide-regulated gene expression in Arabidopsis reveals a high light-induced transcriptional cluster involved in anthocyanin biosynthesis. DOI: 10.1104/pp.105.065896 ; PMID: 16183842
- Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c. DOI: 10.1104/pp.105.070110 ; PMID: 16244138
- Dissecting salt stress pathways. DOI: 10.1093/jxb/erj098 ; PMID: 16510518
- Analysis of gene expression profiles in response to Sclerotinia sclerotiorum in Brassica napus. DOI: 10.1007/s00425-007-0586-z ; PMID: 17665211
- MYC2 differentially modulates diverse jasmonate-dependent functions in Arabidopsis. DOI: 10.1105/tpc.106.048017 ; PMID: 17616737
- Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. DOI: 10.1094/MPMI-20-8-0900 ; PMID: 17722694
- The EDLL motif: a potent plant transcriptional activation domain from AP2/ERF transcription factors. DOI: 10.1111/j.1365-313X.2012.04935.x ; PMID: 22321262
- The ethylene response factor AtERF98 enhances tolerance to salt through the transcriptional activation of ascorbic acid synthesis in Arabidopsis. DOI: 10.1111/j.1365-313X.2012.04996.x ; PMID: 22417285
- Regulation of ascorbic acid synthesis in plants. DOI: 10.4161/psb.24536 ; PMID: 23603957
- The Small Ethylene Response Factor ERF96 is Involved in the Regulation of the Abscisic Acid Response in Arabidopsis. DOI: 10.3389/fpls.2015.01064 ; PMID: 26635862
- From network to phenotype: the dynamic wiring of an Arabidopsis transcriptional network induced by osmotic stress. DOI: 10.15252/msb.20177840 ; PMID: 29269383
- Two interacting ethylene response factors regulate heat stress response. DOI: 10.1093/plcell/koaa026 ; PMID: 33793870
- The AP2/EREBP family of plant transcription factors. DOI: 10.1515/bchm.1998.379.6.633 ; PMID: 9687012
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Genome-wide analysis of the ERF gene family in Arabidopsis and rice. DOI: 10.1104/pp.105.073783 ; PMID: 16407444
- Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. DOI: 10.1094/MPMI-20-8-0900 ; PMID: 17722694
Gene Resources
- UniProt: A0A654F9Y2
- EMBL: CACRSJ010000106
- AlphaFoldDB: A0A654F9Y2
- EnsemblPlants: AT3G23230.1
- Gramene: AT3G23230.1
- KEGG: ath:AT3G23230
- Orthologous matrix: HPIREGC
- ExpressionAtlas: AT3G23230
- InterPro: IPR001471, IPR016177, IPR036955
- PANTHER: PTHR31190, PTHR31190:SF321
- SUPFAM: SSF54171
- PROSITE: PS51032
- Gene3D: 3.30.730.10
- SWISS-MODEL: A0A654F9Y2
- Conserved Domain Database: cd00018
Homologs
- Brassica napus GSBRNA2T00001072001, GSBRNA2T00058554001, GSBRNA2T00128432001, GSBRNA2T00142536001
- Brassica oleracea XP_013594583.1, XP_013597025.1
- Brassica rapa XP_009108122.1, XP_009102648.1
- Cajanus cajan C.cajan_22557
- Raphanus raphanistrum RrC5474_p1, RrC16963_p1
Sequences
cDNA Sequence
- >AT3G23230.1
CAGATGATACTACATAATCCATAATCCATAGATCTCTTATTAAATAACAGTGCTGACCAAGCTCTTACAAAGCAAACCAATCTAGAACACCAAAGTTAATGGAGAGCTCAAACAGGAGCAGCAACAACCAATCACAAGATGACAAGCAAGCTCGTTTCCGGGGAGTTCGAAGAAGGCCTTGGGGAAAGTTTGCAGCAGAGATTCGAGACCCGTCGAGAAACGGTGCCCGTCTTTGGCTCGGGACATTTGAGACCGCTGAGGAGGCAGCAAGGGCTTATGACCGAGCAGCCTTTAACCTTAGGGGTCATCTCGCTATACTCAACTTCCCTAATGAGTATTATCCACGTATGGACGACTACTCGCTTCGCCCTCCTTATGCTTCTTCTTCTTCGTCGTCGTCATCGGGTTCAACTTCTACTAATGTGAGTCGACAAAACCAAAGAGAAGTTTTCGAGTTTGAGTATTTGGACGATAAGGTTCTTGAAGAACTTCTTGATTCAGAAGAAAGGAAGAGATAATCACGATTAGTTTTGTTTTGATATTTTATGTGGCACTGTTGTGGCTACCTACGTGCATTATGTGCATGTATAGGTCGCTTGATTAGTACTTTATAACATGCATGCCACGACCATAAATTGTAAGAGAAGACGTACTTTGCGTTTTCATGAAATATGAATGTTAGATGGTTTGAGTACGTACACCAGCTTTCATTGTTTTTAATATATACATGGATTCAAATAATTCTTCCTTAATGAGATAGATCTTCACTAAGTTACTATATATGAT
CDS Sequence
- >AT3G23230.1
ATGGAGAGCTCAAACAGGAGCAGCAACAACCAATCACAAGATGACAAGCAAGCTCGTTTCCGGGGAGTTCGAAGAAGGCCTTGGGGAAAGTTTGCAGCAGAGATTCGAGACCCGTCGAGAAACGGTGCCCGTCTTTGGCTCGGGACATTTGAGACCGCTGAGGAGGCAGCAAGGGCTTATGACCGAGCAGCCTTTAACCTTAGGGGTCATCTCGCTATACTCAACTTCCCTAATGAGTATTATCCACGTATGGACGACTACTCGCTTCGCCCTCCTTATGCTTCTTCTTCTTCGTCGTCGTCATCGGGTTCAACTTCTACTAATGTGAGTCGACAAAACCAAAGAGAAGTTTTCGAGTTTGAGTATTTGGACGATAAGGTTCTTGAAGAACTTCTTGATTCAGAAGAAAGGAAGAGATAA
Protein Sequence
- >AT3G23230.1
MESSNRSSNNQSQDDKQARFRGVRRRPWGKFAAEIRDPSRNGARLWLGTFETAEEAARAYDRAAFNLRGHLAILNFPNEYYPRMDDYSLRPPYASSSSSSSSGSTSTNVSRQNQREVFEFEYLDDKVLEELLDSEERKR