Gene Details:
- Gene ID: AT3G22370
- Gene Symbol: AOX1A, ATAOX1A, AtHSR3, HSR3
- Gene Name: alternative oxidase 1A, hyper-sensitivity-related 3
- Description: alternative oxidase 1A;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
Function-related keywords:
- shoot axis apex , leaf lamina base , root , shoot system , plant embryo , vascular leaf , stamen , sepal , flower , inflorescence flower pedicel , cotyledon , petiole , hypocotyl , leaf apex , collective leaf structure , pollen , pollen tube cell , pollen
Literature:
- Characterization of the gene family for alternative oxidase from Arabidopsis thaliana. DOI: 10.1023/a:1005818507743 ; PMID: 9349280
- The gene for alternative oxidase-2 (AOX2) from Arabidopsis thaliana consists of five exons unlike other AOX genes and is transcribed at an early stage during germination. DOI: 10.1266/ggs.76.89 ; PMID: 11434463
- Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins. DOI: 10.1105/tpc.016055 ; PMID: 14671022
- Characterization of mitochondrial alternative NAD(P)H dehydrogenases in Arabidopsis: intraorganelle location and expression. DOI: 10.1093/pcp/pci221 ; PMID: 16258072
- Characterization of transformed Arabidopsis with altered alternative oxidase levels and analysis of effects on reactive oxygen species in tissue. DOI: 10.1104/pp.105.070763 ; PMID: 16299171
- The alternative oxidase of plant mitochondria is involved in the acclimation of shoot growth at low temperature. A study of Arabidopsis AOX1a transgenic plants. DOI: 10.1104/pp.105.070789 ; PMID: 16299170
- Mapping the Arabidopsis organelle proteome. DOI: 10.1073/pnas.0506958103 ; PMID: 16618929
- Alternative oxidases in Arabidopsis: a comparative analysis of differential expression in the gene family provides new insights into function of non-phosphorylating bypasses. DOI: 10.1016/j.bbabio.2006.03.009 ; PMID: 16859634
- Alternative oxidase involvement in cold stress response of Arabidopsis thaliana fad2 and FAD3+ cell suspensions altered in membrane lipid composition. DOI: 10.1093/pcp/pcm061 ; PMID: 17507388
- The absence of ALTERNATIVE OXIDASE1a in Arabidopsis results in acute sensitivity to combined light and drought stress. DOI: 10.1104/pp.107.115121 ; PMID: 18424626
- Identification of regulatory pathways controlling gene expression of stress-responsive mitochondrial proteins in Arabidopsis. DOI: 10.1104/pp.108.121384 ; PMID: 18567827
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- The transcription factor ABI4 is a regulator of mitochondrial retrograde expression of ALTERNATIVE OXIDASE1a. DOI: 10.1104/pp.109.139782 ; PMID: 19482916
- Differential gene expression profiles of the mitochondrial respiratory components in illuminated Arabidopsis leaves. DOI: 10.1093/pcp/pcp090 ; PMID: 19567377
- Induction of the AOX1D isoform of alternative oxidase in A. thaliana T-DNA insertion lines lacking isoform AOX1A is insufficient to optimize photosynthesis when treated with antimycin A. DOI: 10.1093/mp/ssn089 ; PMID: 19825614
- Manipulation of alternative oxidase can influence salt tolerance in Arabidopsis thaliana. DOI: 10.1111/j.1399-3054.2009.01305.x ; PMID: 19941623
- Photosynthetic redox imbalance governs leaf sectoring in the Arabidopsis thaliana variegation mutants immutans, spotty, var1, and var2. DOI: 10.1105/tpc.108.062752 ; PMID: 19897671
- ABA overly-sensitive 5 (ABO5), encoding a pentatricopeptide repeat protein required for cis-splicing of mitochondrial nad2 intron 3, is involved in the abscisic acid response in Arabidopsis. DOI: 10.1111/j.1365-313X.2010.04280.x ; PMID: 20561255
- Involvement of ethylene and hydrogen peroxide in induction of alternative respiratory pathway in salt-treated Arabidopsis calluses. DOI: 10.1093/pcp/pcq134 ; PMID: 20801923
- Physiological impact of mitochondrial alternative oxidase on photosynthesis and growth in Arabidopsis thaliana. DOI: 10.1111/j.1365-3040.2011.02384.x ; PMID: 21707657
- Alterations in the mitochondrial alternative NAD(P)H Dehydrogenase NDB4 lead to changes in mitochondrial electron transport chain composition, plant growth and response to oxidative stress. DOI: 10.1093/pcp/pcr073 ; PMID: 21659327
- The Arabidopsis mitochondria-localized pentatricopeptide repeat protein PGN functions in defense against necrotrophic fungi and abiotic stress tolerance. DOI: 10.1104/pp.111.177501 ; PMID: 21653783
- Cysteine biosynthesis, in concert with a novel mechanism, contributes to sulfide detoxification in mitochondria of Arabidopsis thaliana. DOI: 10.1042/BJ20120038 ; PMID: 22551219
- Arabidopsis SIZ1 positively regulates alternative respiratory bypass pathways. DOI: 10.5483/bmbrep.2012.45.6.010 ; PMID: 22732219
- AtWRKY40 and AtWRKY63 modulate the expression of stress-responsive nuclear genes encoding mitochondrial and chloroplast proteins. DOI: 10.1104/pp.113.215996 ; PMID: 23509177
- Transient transcriptional regulation of the CYS-C1 gene and cyanide accumulation upon pathogen infection in the plant immune response. DOI: 10.1104/pp.113.219436 ; PMID: 23784464
- A membrane-bound NAC transcription factor, ANAC017, mediates mitochondrial retrograde signaling in Arabidopsis. DOI: 10.1105/tpc.113.113985 ; PMID: 24045017
- Suppression of NDA-type alternative mitochondrial NAD(P)H dehydrogenases in arabidopsis thaliana modifies growth and metabolism, but not high light stimulation of mitochondrial electron transport. DOI: 10.1093/pcp/pcu021 ; PMID: 24486764
- A Functional Antagonistic Relationship between Auxin and Mitochondrial Retrograde Signaling Regulates Alternative Oxidase1a Expression in Arabidopsis. DOI: 10.1104/pp.114.237495 ; PMID: 24820025
- Protein phosphatase 2A (PP2A) regulatory subunit B'γ interacts with cytoplasmic ACONITASE 3 and modulates the abundance of AOX1A and AOX1D in Arabidopsis thaliana. DOI: 10.1111/nph.13097 ; PMID: 25307043
- Fermentation and alternative oxidase contribute to the action of amino acid biosynthesis-inhibiting herbicides. DOI: 10.1016/j.jplph.2014.12.004 ; PMID: 25544587
- An Arabidopsis mitochondria-localized RRL protein mediates abscisic acid signal transduction through mitochondrial retrograde regulation involving ABI4. DOI: 10.1093/jxb/erv356 ; PMID: 26163700
- Importance of the alternative oxidase (AOX) pathway in regulating cellular redox and ROS homeostasis to optimize photosynthesis during restriction of the cytochrome oxidase pathway in Arabidopsis thaliana. DOI: 10.1093/aob/mcv122 ; PMID: 26292995
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Retrograde signalling caused by heritable mitochondrial dysfunction is partially mediated by ANAC017 and improves plant performance. DOI: 10.1111/tpj.13276 ; PMID: 27425258
- Analysis of Posttranslational Activation of Alternative Oxidase Isoforms. DOI: 10.1104/pp.17.00681 ; PMID: 28596420
- Inhibitor-induced oxidation of the nucleus and cytosol in Arabidopsis thaliana: implications for organelle to nucleus retrograde signalling. DOI: 10.1098/rstb.2016.0392 ; PMID: 28808105
- Alternative Oxidase Isoforms Are Differentially Activated by Tricarboxylic Acid Cycle Intermediates. DOI: 10.1104/pp.17.01331 ; PMID: 29208641
- UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana. DOI: 10.1111/pce.13166 ; PMID: 29447428
- The ERA-Related GTPase AtERG2 Associated with Mitochondria 18S RNA Is Essential for Early Embryo Development in Arabidopsis. DOI: 10.3389/fpls.2018.00182 ; PMID: 29497438
- A discrete role for alternative oxidase under hypoxia to increase nitric oxide and drive energy production. DOI: 10.1016/j.freeradbiomed.2018.03.045 ; PMID: 29604396
- SELENOPROTEIN O is a chloroplast protein involved in ROS scavenging and its absence increases dehydration tolerance in Arabidopsis thaliana. DOI: 10.1016/j.plantsci.2018.02.023 ; PMID: 29576081
- The Zinc-Finger Thylakoid-Membrane Protein FIP Is Involved With Abiotic Stress Response in Arabidopsis thaliana. DOI: 10.3389/fpls.2018.00504 ; PMID: 29720990
- Targeted Proteomics Approach Toward Understanding the Role of the Mitochondrial Protease FTSH4 in the Biogenesis of OXPHOS During Arabidopsis Seed Germination. DOI: 10.3389/fpls.2018.00821 ; PMID: 29963070
- Mitochondrial function modulates touch signalling in Arabidopsis thaliana. DOI: 10.1111/tpj.14183 ; PMID: 30537160
- Comparison of the response of alternative oxidase and uncoupling proteins to bacterial elicitor induced oxidative burst. DOI: 10.1371/journal.pone.0210592 ; PMID: 30629714
- AtNDB2 Is the Main External NADH Dehydrogenase in Mitochondria and Is Important for Tolerance to Environmental Stress. DOI: 10.1104/pp.19.00877 ; PMID: 31409698
- Mitochondrial AOX Supports Redox Balance of Photosynthetic Electron Transport, Primary Metabolite Balance, and Growth in Arabidopsis thaliana under High Light. DOI: 10.3390/ijms20123067 ; PMID: 31234590
- Involvement of active MKK9-MAPK3/MAPK6 in increasing respiration in salt-treated Arabidopsis callus. DOI: 10.1007/s00709-020-01483-3 ; PMID: 32008084
- PWR/HDA9/ABI4 Complex Epigenetically Regulates ABA Dependent Drought Stress Tolerance in Arabidopsis. DOI: 10.3389/fpls.2020.00623 ; PMID: 32528497
- Arabidopsis Plastid-RNA Polymerase RPOTp Is Involved in Abiotic Stress Tolerance. DOI: 10.3390/plants9070834 ; PMID: 32630785
- Retrograde signalling from the mitochondria to the nucleus translates the positive effect of ethylene on dormancy breaking of Arabidopsis thaliana seeds. DOI: 10.1111/nph.16985 ; PMID: 33020928
- Melatonin mitigates UV-B stress via regulating oxidative stress response, cellular redox and alternative electron sinks in Arabidopsis thaliana. DOI: 10.1016/j.phytochem.2020.112592 ; PMID: 33316594
- Functional Relationship of Arabidopsis AOXs and PTOX Revealed via Transgenic Analysis. DOI: 10.3389/fpls.2021.692847 ; PMID: 34367216
- Responses of genes of DNA repair, alternative oxidase, and pro-/antioxidant state in Arabidopsis thaliana with altered expression of AOX1a to gamma irradiation. DOI: 10.1080/09553002.2022.1998712 ; PMID: 34714725
- Reductive stress triggers ANAC017-mediated retrograde signaling to safeguard the endoplasmic reticulum by boosting mitochondrial respiratory capacity. DOI: 10.1093/plcell/koac017 ; PMID: 35078237
- The Melatonin Receptor CAND2/PMTR1 Is Involved in the Regulation of Mitochondrial Gene Expression under Photooxidative Stress. DOI: 10.1134/S1607672922010021 ; PMID: 35275300
- The significance of WRKY45 transcription factor in metabolic adjustments during dark-induced leaf senescence. DOI: 10.1111/pce.14393 ; PMID: 35818668
- Coordinated regulation of the mitochondrial retrograde response by circadian clock regulators and ANAC017. DOI: 10.1016/j.xplc.2022.100501 ; PMID: 36463409
- Alternative oxidase 1a and 1d enable metabolic flexibility during Ala catabolism in Arabidopsis. DOI: 10.1093/plphys/kiad233 ; PMID: 37128995
- Characterization of the gene family for alternative oxidase from Arabidopsis thaliana. DOI: 10.1023/a:1005818507743 ; PMID: 9349280
- Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins. DOI: 10.1105/tpc.016055 ; PMID: 14671022
- The hydrophobic proteome of mitochondrial membranes from Arabidopsis cell suspensions. DOI: 10.1016/j.phytochem.2004.03.028 ; PMID: 15276431
- Mapping the Arabidopsis organelle proteome. DOI: 10.1073/pnas.0506958103 ; PMID: 16618929
- The absence of ALTERNATIVE OXIDASE1a in Arabidopsis results in acute sensitivity to combined light and drought stress. DOI: 10.1104/pp.107.115121 ; PMID: 18424626
Sequences:
cDNA Sequence
- >AT3G22370.1
GGCGACCACGCAAGTATCTTCCATCTTGCTCTCCAAGAAAAATCTACACCGGCTTTAAATTTACATAAACACCCTCAGTCAAAGAAAAGTCGTAAACATAGTCTCTCTCATGACCACAAGGGTAACACAGTCATCCTAAATATAAACCACACAAGAAAACTGTTATACTTTATACACGTGTCATAGTCTCATTACATCTACGTGAAGAGTTTCGATCATCAACCGTTCGTTTTCTTACTATATAAACCTTGCTCGAGACCTGCGTGTGAAGCGTATAAAGACGACAAAGTAAACCAAAAAAAAAAAGAGTTCTCCTACAATTTTCCTAAATTCTTGGATTTGAGATTTCACTTTTTCCGATTTGAAACAATGATGATAACTCGCGGTGGAGCCAAGGCGGCGAAATCGCTGTTAGTGGCGGCTGGACCACGTTTGTTCTCGACGGTCCGTACGGTTTCGTCTCACGAGGCTTTATCAGCAAGCCATATTTTGAAGCCTGGTGTTACATCTGCTTGGATATGGACTAGAGCTCCGACGATTGGAGGTATGAGATTCGCTAGCACGATCACTCTGGGAGAGAAAACTCCGATGAAGGAGGAGGACGCGAATCAGAAGAAAACAGAGAACGAATCCACCGGTGGAGACGCCGCCGGAGGTAATAACAAGGGAGATAAAGGAATCGCGAGCTATTGGGGTGTTGAACCTAATAAGATTACTAAAGAAGATGGTTCTGAATGGAAGTGGAACTGTTTCAGGCCATGGGAAACGTATAAAGCTGATATAACGATAGATCTGAAGAAGCATCATGTTCCAACGACGTTTCTTGATAGAATAGCTTATTGGACTGTTAAATCTCTTCGTTGGCCTACCGATTTGTTCTTCCAGAGGAGATATGGATGTCGAGCTATGATGCTTGAAACTGTAGCAGCAGTACCTGGAATGGTTGGAGGAATGTTACTACACTGCAAATCGCTTCGACGTTTTGAGCAAAGTGGAGGATGGATTAAGGCTCTTCTTGAGGAAGCAGAGAATGAGAGAATGCATCTTATGACATTCATGGAAGTCGCGAAACCGAAATGGTACGAGAGAGCGCTCGTGATCACTGTGCAAGGAGTCTTCTTCAACGCTTATTTCCTTGGTTACTTAATCTCTCCCAAGTTTGCTCATCGTATGGTTGGGTACCTTGAAGAAGAAGCGATCCATTCTTATACTGAGTTTCTCAAGGAACTTGACAAAGGTAACATTGAGAATGTTCCTGCTCCGGCTATTGCTATTGATTACTGGAGGCTTCCTGCTGATGCGACACTTCGTGATGTTGTGATGGTTGTTCGTGCTGACGAGGCTCATCACCGTGATGTAAACCATTTTGCATCTGATATTCACTACCAAGGTCGTGAACTAAAGGAAGCTCCAGCTCCAATTGGGTATCATTGATTCGATTAAAAGAAGAGCTTTTTCTCAAGTTTAAAACTTTGTTCTAAAGAATTTAAGTTCTTTGACTTGTATATACATCATCACCTCTGCTTAAGCCATACTTGGATTCGGCTTTCTTTGAATGTTGCTACGAATGTTCTGATTTCTTCTTTACTTTTCCTGTCAATGGGCTTTTGGGCTTATCTTTTGCTATTGTATGGCCTTGCTATTTAGAATGAGAGTAATAGTTTGTAGAAGCTGCTACTAAATCATGTAAAGATACCATTGATATCATCATAACTATTCAATTTCATATGGAAATCAATTAATATACCATCTACATTGACAAAA
CDS Sequence
- >AT3G22370.1
ATGATGATAACTCGCGGTGGAGCCAAGGCGGCGAAATCGCTGTTAGTGGCGGCTGGACCACGTTTGTTCTCGACGGTCCGTACGGTTTCGTCTCACGAGGCTTTATCAGCAAGCCATATTTTGAAGCCTGGTGTTACATCTGCTTGGATATGGACTAGAGCTCCGACGATTGGAGGTATGAGATTCGCTAGCACGATCACTCTGGGAGAGAAAACTCCGATGAAGGAGGAGGACGCGAATCAGAAGAAAACAGAGAACGAATCCACCGGTGGAGACGCCGCCGGAGGTAATAACAAGGGAGATAAAGGAATCGCGAGCTATTGGGGTGTTGAACCTAATAAGATTACTAAAGAAGATGGTTCTGAATGGAAGTGGAACTGTTTCAGGCCATGGGAAACGTATAAAGCTGATATAACGATAGATCTGAAGAAGCATCATGTTCCAACGACGTTTCTTGATAGAATAGCTTATTGGACTGTTAAATCTCTTCGTTGGCCTACCGATTTGTTCTTCCAGAGGAGATATGGATGTCGAGCTATGATGCTTGAAACTGTAGCAGCAGTACCTGGAATGGTTGGAGGAATGTTACTACACTGCAAATCGCTTCGACGTTTTGAGCAAAGTGGAGGATGGATTAAGGCTCTTCTTGAGGAAGCAGAGAATGAGAGAATGCATCTTATGACATTCATGGAAGTCGCGAAACCGAAATGGTACGAGAGAGCGCTCGTGATCACTGTGCAAGGAGTCTTCTTCAACGCTTATTTCCTTGGTTACTTAATCTCTCCCAAGTTTGCTCATCGTATGGTTGGGTACCTTGAAGAAGAAGCGATCCATTCTTATACTGAGTTTCTCAAGGAACTTGACAAAGGTAACATTGAGAATGTTCCTGCTCCGGCTATTGCTATTGATTACTGGAGGCTTCCTGCTGATGCGACACTTCGTGATGTTGTGATGGTTGTTCGTGCTGACGAGGCTCATCACCGTGATGTAAACCATTTTGCATCTGATATTCACTACCAAGGTCGTGAACTAAAGGAAGCTCCAGCTCCAATTGGGTATCATTGA
Protein Sequence
- >AT3G22370.1
MMITRGGAKAAKSLLVAAGPRLFSTVRTVSSHEALSASHILKPGVTSAWIWTRAPTIGGMRFASTITLGEKTPMKEEDANQKKTENESTGGDAAGGNNKGDKGIASYWGVEPNKITKEDGSEWKWNCFRPWETYKADITIDLKKHHVPTTFLDRIAYWTVKSLRWPTDLFFQRRYGCRAMMLETVAAVPGMVGGMLLHCKSLRRFEQSGGWIKALLEEAENERMHLMTFMEVAKPKWYERALVITVQGVFFNAYFLGYLISPKFAHRMVGYLEEEAIHSYTEFLKELDKGNIENVPAPAIAIDYWRLPADATLRDVVMVVRADEAHHRDVNHFASDIHYQGRELKEAPAPIGYH