Information report for AT3G21630
Gene Details
|
|
Functional Descriptions
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- 096F09 — Induction of all chitooligosaccharide- responsive genes was blocked in the mutant. Mutant showed more susceptibility to fungal pa thogens but had no effect on bacterial infection, neither affected the SA- and jasmonic acid/ethylene-responsive pathways.
- cerk1-1 — completely lost the ability to respond to the chitin elicitor
- cerk1-2 — completely lost the ability to respond to the chitin elicitor
- cerk1-4 — Enhanced SA-dependent cell death response to powdery mildew.
- xlg2-2/cerk1-4 — Double mutant suppresses the hyperimmunity of cerk1-4 single mutant. Reduces lesions caused by powdery mildew fungus Blumeria graminis f. sp. hordei infection.
Functional Keywords
Literature and News
- Expansion of the receptor-like kinase/Pelle gene family and receptor-like proteins in Arabidopsis. DOI: 10.1104/pp.103.021964 ; PMID: 12805585
- The ULTRACURVATA2 gene of Arabidopsis encodes an FK506-binding protein involved in auxin and brassinosteroid signaling. DOI: 10.1104/pp.103.032524 ; PMID: 14730066
- Lectin receptor kinases participate in protein-protein interactions to mediate plasma membrane-cell wall adhesions in Arabidopsis. DOI: 10.1104/pp.105.066464 ; PMID: 16361528
- Comparison of gene expression in segregating families identifies genes and genomic regions involved in a novel adaptation, zinc hyperaccumulation. DOI: 10.1111/j.1365-294X.2006.02981.x ; PMID: 16911220
- A LysM receptor-like kinase plays a critical role in chitin signaling and fungal resistance in Arabidopsis. DOI: 10.1105/tpc.107.056754 ; PMID: 18263776
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Autophosphorylation profiling of Arabidopsis protein kinases using the cell-free system. DOI: 10.1016/j.phytochem.2011.02.029 ; PMID: 21477822
- Arabidopsis lysin-motif proteins LYM1 LYM3 CERK1 mediate bacterial peptidoglycan sensing and immunity to bacterial infection. DOI: 10.1073/pnas.1112862108 ; PMID: 22106285
- LYK4, a lysin motif receptor-like kinase, is important for chitin signaling and plant innate immunity in Arabidopsis. DOI: 10.1104/pp.112.201699 ; PMID: 22744984
- How plant lysin motif receptors get activated: lessons learned from structural biology. DOI: 10.1126/scisignal.2003274 ; PMID: 22740685
- Chitin-induced dimerization activates a plant immune receptor. DOI: 10.1126/science.1218867 ; PMID: 22654057
- Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants. DOI: 10.1093/pcp/pcs113 ; PMID: 22891159
- Heterotrimeric G proteins serve as a converging point in plant defense signaling activated by multiple receptor-like kinases. DOI: 10.1104/pp.112.212431 ; PMID: 23424249
- LYM2-dependent chitin perception limits molecular flux via plasmodesmata. DOI: 10.1073/pnas.1203458110 ; PMID: 23674687
- Presence of LYM2 dependent but CERK1 independent disease resistance in Arabidopsis. DOI: 10.4161/psb.25345 ; PMID: 23803749
- Interaction of Medicago truncatula lysin motif receptor-like kinases, NFP and LYK3, produced in Nicotiana benthamiana induces defence-like responses. DOI: 10.1371/journal.pone.0065055 ; PMID: 23750228
- The Arabidopsis LYSIN MOTIF-CONTAINING RECEPTOR-LIKE KINASE3 regulates the cross talk between immunity and abscisic acid responses. DOI: 10.1104/pp.113.233759 ; PMID: 24639336
- Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27. DOI: 10.1111/tpj.12535 ; PMID: 24750441
- The kinase LYK5 is a major chitin receptor in Arabidopsis and forms a chitin-induced complex with related kinase CERK1. DOI: 10.7554/eLife.03766 ; PMID: 25340959
- Splicing of receptor-like kinase-encoding SNC4 and CERK1 is regulated by two conserved splicing factors that are required for plant immunity. DOI: 10.1093/mp/ssu103 ; PMID: 25267732
- The synthetic cationic lipid diC14 activates a sector of the Arabidopsis defence network requiring endogenous signalling components. DOI: 10.1111/mpp.12252 ; PMID: 25727690
- The Arabidopsis Malectin-Like/LRR-RLK IOS1 Is Critical for BAK1-Dependent and BAK1-Independent Pattern-Triggered Immunity. DOI: 10.1105/tpc.16.00313 ; PMID: 27317676
- Chitin receptor CERK1 links salt stress and chitin-triggered innate immunity in Arabidopsis. DOI: 10.1111/tpj.13437 ; PMID: 27888535
- Arabidopsis E3 ubiquitin ligase PLANT U-BOX13 (PUB13) regulates chitin receptor LYSIN MOTIF RECEPTOR KINASE5 (LYK5) protein abundance. DOI: 10.1111/nph.14472 ; PMID: 28195333
- Chitin-induced and CHITIN ELICITOR RECEPTOR KINASE1 (CERK1) phosphorylation-dependent endocytosis of Arabidopsis thaliana LYSIN MOTIF-CONTAINING RECEPTOR-LIKE KINASE5 (LYK5). DOI: 10.1111/nph.14592 ; PMID: 28513921
- Genome-Wide Screening for Lectin Motifs in Arabidopsis thaliana. DOI: 10.3835/plantgenome2017.02.0010 ; PMID: 28724081
- Non-branched β-1,3-glucan oligosaccharides trigger immune responses in Arabidopsis. DOI: 10.1111/tpj.13755 ; PMID: 29083116
- Arabidopsis ubiquitin ligase PUB12 interacts with and negatively regulates Chitin Elicitor Receptor Kinase 1 (CERK1). DOI: 10.1371/journal.pone.0188886 ; PMID: 29182677
- A Tyrosine Phosphorylation Cycle Regulates Fungal Activation of a Plant Receptor Ser/Thr Kinase. DOI: 10.1016/j.chom.2017.12.005 ; PMID: 29396039
- The Beneficial Root-Colonizing Fungus Mortierella hyalina Promotes the Aerial Growth of Arabidopsis and Activates Calcium-Dependent Responses That Restrict Alternaria brassicae-Induced Disease Development in Roots. DOI: 10.1094/MPMI-05-18-0115-R ; PMID: 30252617
- AtCERK1 Phosphorylation Site S493 Contributes to the Transphosphorylation of Downstream Components for Chitin-Induced Immune Signaling. DOI: 10.1093/pcp/pcz096 ; PMID: 31119298
- LYK4 is a component of a tripartite chitin receptor complex in Arabidopsis thaliana. DOI: 10.1093/jxb/erz313 ; PMID: 31270545
- Chitin synthase is involved in vegetative growth, asexual reproduction and pathogenesis of Phytophthora capsici and Phytophthora sojae. DOI: 10.1111/1462-2920.14744 ; PMID: 31314944
- PUB4, a CERK1-Interacting Ubiquitin Ligase, Positively Regulates MAMP-Triggered Immunity in Arabidopsis. DOI: 10.1093/pcp/pcz151 ; PMID: 31368495
- Vascular bundle sheath and mesophyll cells modulate leaf water balance in response to chitin. DOI: 10.1111/tpj.14598 ; PMID: 31680316
- Exogenous Treatment with Glutamate Induces Immune Responses in Arabidopsis. DOI: 10.1094/MPMI-09-19-0262-R ; PMID: 31721650
- A method for functional testing constitutive and ligand-induced interactions of lysin motif receptor proteins. DOI: 10.1186/s13007-020-0551-4 ; PMID: 31969929
- A plant genetic network for preventing dysbiosis in the phyllosphere. DOI: 10.1038/s41586-020-2185-0 ; PMID: 32350464
- Arabidopsis CPK5 Phosphorylates the Chitin Receptor LYK5 to Regulate Plant Innate Immunity. DOI: 10.3389/fpls.2020.00702 ; PMID: 32595659
- Stomatal immunity against fungal invasion comprises not only chitin-induced stomatal closure but also chitosan-induced guard cell death. DOI: 10.1073/pnas.1922319117 ; PMID: 32778594
- Enhanced thermotolerance of Arabidopsis by chitooligosaccharides-induced CERK1n-ERc fusion gene. DOI: 10.1080/15592324.2020.1816322 ; PMID: 32902365
- Computational prediction method to decipher receptor-glycoligand interactions in plant immunity. DOI: 10.1111/tpj.15133 ; PMID: 33316845
- Regulation of the microsomal proteome by salicylic acid and deficiency of phosphatidylinositol-4-kinases β1 and β2 in Arabidopsis thaliana. DOI: 10.1002/pmic.202000223 ; PMID: 33463038
- Cell wall-derived mixed-linked β-1,3/1,4-glucans trigger immune responses and disease resistance in plants. DOI: 10.1111/tpj.15185 ; PMID: 33544927
- The receptor-like cytoplasmic kinase CDG1 negatively regulates Arabidopsis pattern-triggered immunity and is involved in AvrRpm1-induced RIN4 phosphorylation. DOI: 10.1093/plcell/koab033 ; PMID: 33619522
- Pattern-recognition receptors are required for NLR-mediated plant immunity. DOI: 10.1038/s41586-021-03316-6 ; PMID: 33692546
- MAMP and DAMP signaling contributes resistance to Fusarium graminearum in Arabidopsis. DOI: 10.1093/jxb/erab285 ; PMID: 34405877
- The Arabidopsis thaliana LysM-containing Receptor-Like Kinase 2 is required for elicitor-induced resistance to pathogens. DOI: 10.1111/pce.14192 ; PMID: 34558681
- Sphingolipids with 2-hydroxy fatty acids aid in plasma membrane nanodomain organization and oxidative burst. DOI: 10.1093/plphys/kiac134 ; PMID: 35312013
- EXTRA LARGE G-PROTEIN2 mediates cell death and hyperimmunity in the chitin elicitor receptor kinase 1-4 mutant. DOI: 10.1093/plphys/kiac214 ; PMID: 35522044
- A Case of Plant Vaccination: Enhancement of Plant Immunity against Verticillium dahliae by Necrotized Spores of the Pathogen. DOI: 10.3390/plants11131691 ; PMID: 35807643
- Quantitative phosphoproteomics of early elicitor signaling in Arabidopsis. DOI: 10.1074/mcp.M600429-MCP200 ; PMID: 17317660
- MASCP Gator: an aggregation portal for the visualization of Arabidopsis proteomics data. DOI: 10.1104/pp.110.168195 ; PMID: 21075962
Gene Resources
- UniProt: A0A654F9D5
- EMBL: CACRSJ010000106, CACSHJ010000089
- AlphaFoldDB: A0A654F9D5
- EnsemblPlants: AT3G21630.1
- Gramene: AT3G21630.1
- KEGG: ath:AT3G21630
- Orthologous matrix: PWTKRVQ
- ExpressionAtlas: AT3G21630
- InterPro: IPR000719, IPR001245, IPR008271
- PANTHER: PTHR46204, PTHR46204:SF30
- SUPFAM: SSF56112
- PROSITE: PS00107, PS00108, PS50011
- Gene3D: 1.10.510.10, 3.30.200.20
- OrthoDB: A0A654F9D5
- SWISS-MODEL: A0A654F9D5
- Conserved Domain Database: cd00118
Homologs
- Brassica napus GSBRNA2T00066324001, GSBRNA2T00079964001
- Brassica oleracea Bo5g099900, Bol038347
- Brassica rapa Brara.E02055
Sequences
cDNA Sequence
- >AT3G21630.1
ATTCTCTTTAGTTGAAAAAAATAGTCAACGTTTGATTAAGTCAACCTTTTTCGTCTTTGAATCCATCTTCTTCCCCACAGAGCAACGACGAAACAAAAAAAACAGAGACCCTTCCTCTGGGGAATCTAAGGAAGCTTCAAAATGAAGCTAAAGATTTCTCTAATCGCTCCGATTCTTCTTCTCTTCTCATTCTTCTTCGCCGTGGAATCTAAGTGCAGGACTAGCTGTCCTTTAGCTCTAGCTTCGTACTATCTCGAGAACGGAACAACACTCTCCGTCATCAACCAAAACCTCAATTCTTCAATCGCGCCTTACGATCAAATCAATTTCGATCCAATCCTCAGGTACAACAGTAACATTAAAGACAAAGATAGAATCCAGATGGGCTCTAGGGTTCTTGTACCTTTCCCTTGCGAATGTCAACCTGGTGATTTCCTAGGGCACAATTTCAGCTACAGTGTTCGACAGGAAGATACTTACGAAAGAGTCGCGATTAGTAATTACGCGAATCTCACGACGATGGAGTCGTTACAGGCGAGGAATCCTTTTCCGGCGACTAACATACCTCTCTCTGCGACGCTTAATGTATTGGTGAATTGTTCTTGTGGTGATGAGAGTGTTTCGAAAGATTTTGGTTTGTTTGTTACGTATCCGCTTCGTCCTGAAGACAGTCTCAGTTCTATTGCGAGATCTTCCGGTGTATCGGCGGATATTCTGCAGAGATATAATCCCGGTGTTAATTTTAACTCCGGGAATGGAATCGTTTATGTGCCTGGAAGAGATCCAAATGGTGCATTTCCACCATTCAAATCAAGTAAACAAGATGGTGTTGGTGCTGGAGTTATTGCTGGTATAGTTATAGGAGTGATTGTGGCTTTGTTGTTGATCTTGTTTATCGTATATTATGCTTACCGGAAGAATAAGTCGAAGGGTGATTCGTTTTCTTCTTCTATTCCGTTGTCTACTAAGGCTGATCATGCTTCTTCTACTAGTCTCCAAAGTGGAGGTTTGGGTGGTGCCGGAGTGTCTCCTGGCATTGCTGCCATAAGCGTGGACAAATCTGTTGAGTTTTCGTTGGAGGAACTAGCAAAGGCTACTGATAATTTCAATTTGTCTTTTAAGATTGGGCAAGGTGGTTTTGGGGCTGTTTACTATGCAGAGCTGAGAGGAGAAAAAGCTGCGATTAAGAAGATGGACATGGAGGCATCGAAACAGTTCTTGGCGGAACTAAAAGTCTTAACGCGTGTACATCATGTCAACCTGGTTCGCCTGATTGGATATTGTGTTGAGGGATCACTTTTCTTGGTGTATGAATATGTTGAGAATGGTAACCTTGGACAACATTTACATGGGTCAGGACGAGAACCATTACCGTGGACTAAGAGAGTGCAGATTGCACTAGACTCAGCTAGAGGTTTAGAATATATCCACGAGCACACGGTTCCAGTTTATGTCCATAGGGACATTAAATCTGCCAATATTTTGATAGACCAGAAATTCCGAGCAAAGGTAGCAGATTTCGGGTTAACAAAACTGACAGAAGTTGGAGGTTCAGCAACTCGGGGTGCAATGGGTACATTTGGTTACATGGCACCAGAGACTGTTTATGGAGAAGTGTCTGCAAAAGTAGATGTATATGCATTTGGAGTTGTCCTTTACGAATTGATTTCTGCGAAAGGTGCGGTTGTCAAAATGACAGAAGCCGTTGGTGAATTTAGAGGCCTTGTTGGTGTGTTCGAAGAATCATTCAAGGAAACCGACAAAGAAGAAGCACTACGCAAGATTATAGACCCGAGGCTCGGTGATAGTTACCCGTTTGATTCGGTATACAAGATGGCGGAATTAGGGAAAGCATGTACACAAGAGAATGCGCAGCTACGTCCGAGTATGAGATACATTGTGGTTGCTTTATCCACTCTCTTTTCGTCTACCGGAAATTGGGATGTTGGAAACTTCCAAAACGAAGATTTAGTCAGTCTTATGTCCGGCCGGTAGACTCGTTTTCCGGTTTGCTGTTGTTATATAGAAATGATTGTTTTTTGGTATGCTCACGTATATTTTGTCTGTCTATACGAACTTTACATGTCACAACTCACAAGTTGACTTTTATATGATTTTCTATAACGCTCTATATGTCAATTATTCAACGTCTCCGATATCAGCATCTCACGTCAAAGATAA
CDS Sequence
- >AT3G21630.1
ATGAAGCTAAAGATTTCTCTAATCGCTCCGATTCTTCTTCTCTTCTCATTCTTCTTCGCCGTGGAATCTAAGTGCAGGACTAGCTGTCCTTTAGCTCTAGCTTCGTACTATCTCGAGAACGGAACAACACTCTCCGTCATCAACCAAAACCTCAATTCTTCAATCGCGCCTTACGATCAAATCAATTTCGATCCAATCCTCAGGTACAACAGTAACATTAAAGACAAAGATAGAATCCAGATGGGCTCTAGGGTTCTTGTACCTTTCCCTTGCGAATGTCAACCTGGTGATTTCCTAGGGCACAATTTCAGCTACAGTGTTCGACAGGAAGATACTTACGAAAGAGTCGCGATTAGTAATTACGCGAATCTCACGACGATGGAGTCGTTACAGGCGAGGAATCCTTTTCCGGCGACTAACATACCTCTCTCTGCGACGCTTAATGTATTGGTGAATTGTTCTTGTGGTGATGAGAGTGTTTCGAAAGATTTTGGTTTGTTTGTTACGTATCCGCTTCGTCCTGAAGACAGTCTCAGTTCTATTGCGAGATCTTCCGGTGTATCGGCGGATATTCTGCAGAGATATAATCCCGGTGTTAATTTTAACTCCGGGAATGGAATCGTTTATGTGCCTGGAAGAGATCCAAATGGTGCATTTCCACCATTCAAATCAAGTAAACAAGATGGTGTTGGTGCTGGAGTTATTGCTGGTATAGTTATAGGAGTGATTGTGGCTTTGTTGTTGATCTTGTTTATCGTATATTATGCTTACCGGAAGAATAAGTCGAAGGGTGATTCGTTTTCTTCTTCTATTCCGTTGTCTACTAAGGCTGATCATGCTTCTTCTACTAGTCTCCAAAGTGGAGGTTTGGGTGGTGCCGGAGTGTCTCCTGGCATTGCTGCCATAAGCGTGGACAAATCTGTTGAGTTTTCGTTGGAGGAACTAGCAAAGGCTACTGATAATTTCAATTTGTCTTTTAAGATTGGGCAAGGTGGTTTTGGGGCTGTTTACTATGCAGAGCTGAGAGGAGAAAAAGCTGCGATTAAGAAGATGGACATGGAGGCATCGAAACAGTTCTTGGCGGAACTAAAAGTCTTAACGCGTGTACATCATGTCAACCTGGTTCGCCTGATTGGATATTGTGTTGAGGGATCACTTTTCTTGGTGTATGAATATGTTGAGAATGGTAACCTTGGACAACATTTACATGGGTCAGGACGAGAACCATTACCGTGGACTAAGAGAGTGCAGATTGCACTAGACTCAGCTAGAGGTTTAGAATATATCCACGAGCACACGGTTCCAGTTTATGTCCATAGGGACATTAAATCTGCCAATATTTTGATAGACCAGAAATTCCGAGCAAAGGTAGCAGATTTCGGGTTAACAAAACTGACAGAAGTTGGAGGTTCAGCAACTCGGGGTGCAATGGGTACATTTGGTTACATGGCACCAGAGACTGTTTATGGAGAAGTGTCTGCAAAAGTAGATGTATATGCATTTGGAGTTGTCCTTTACGAATTGATTTCTGCGAAAGGTGCGGTTGTCAAAATGACAGAAGCCGTTGGTGAATTTAGAGGCCTTGTTGGTGTGTTCGAAGAATCATTCAAGGAAACCGACAAAGAAGAAGCACTACGCAAGATTATAGACCCGAGGCTCGGTGATAGTTACCCGTTTGATTCGGTATACAAGATGGCGGAATTAGGGAAAGCATGTACACAAGAGAATGCGCAGCTACGTCCGAGTATGAGATACATTGTGGTTGCTTTATCCACTCTCTTTTCGTCTACCGGAAATTGGGATGTTGGAAACTTCCAAAACGAAGATTTAGTCAGTCTTATGTCCGGCCGGTAG
Protein Sequence
- >AT3G21630.1
MKLKISLIAPILLLFSFFFAVESKCRTSCPLALASYYLENGTTLSVINQNLNSSIAPYDQINFDPILRYNSNIKDKDRIQMGSRVLVPFPCECQPGDFLGHNFSYSVRQEDTYERVAISNYANLTTMESLQARNPFPATNIPLSATLNVLVNCSCGDESVSKDFGLFVTYPLRPEDSLSSIARSSGVSADILQRYNPGVNFNSGNGIVYVPGRDPNGAFPPFKSSKQDGVGAGVIAGIVIGVIVALLLILFIVYYAYRKNKSKGDSFSSSIPLSTKADHASSTSLQSGGLGGAGVSPGIAAISVDKSVEFSLEELAKATDNFNLSFKIGQGGFGAVYYAELRGEKAAIKKMDMEASKQFLAELKVLTRVHHVNLVRLIGYCVEGSLFLVYEYVENGNLGQHLHGSGREPLPWTKRVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQKFRAKVADFGLTKLTEVGGSATRGAMGTFGYMAPETVYGEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGEFRGLVGVFEESFKETDKEEALRKIIDPRLGDSYPFDSVYKMAELGKACTQENAQLRPSMRYIVVALSTLFSSTGNWDVGNFQNEDLVSLMSGR