Gene Details:
- Gene ID: AT3G20740
- Gene Symbol: FIE, FIE1, FIS3
- Gene Name: FERTILIZATION-INDEPENDENT ENDOSPERM, FERTILIZATION-INDEPENDENT ENDOSPERM 1
- Description: Transducin/WD40 repeat-like superfamily protein;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000198 — free nuclear endosperm — endosperma con núcleos libres (Spanish, exact), 遊離核型胚乳 (Japanese, exact), cenocytic endosperm (related), coenocytic endosperm (related), nuclear endosperm (related)
- PO:0020003 — plant ovule — óvulo vegetal (Spanish, exact), 胚珠 (Japanese, exact), Poaceae ovule (narrow), Zea ovule (narrow)
Germplasm Phenotype:
- CS71712 — Embryo lethal.
- CS73242 — female gametophytic lethal; 50% seed abortion in heterozygous plants
- CS8172 — Autonomous seed development is initiated in absence of fertilization, with a penetrance of about 77%; autonomous seeds do not contain an embryo but only endosperm; autonomous endosperm development is accompanied by increase in pistil elongation and ovule size, leading to a small developing seed that contains endosperm. Abnormal development of the endosperm posterior pole with a cyst and nodules larger than in the wild type; ectopic location of nodules in the peripheral endosperm; absence of cellularisation and overproliferation at late stages. Gametophytic maternal effect results in embryo lethality.
- fie — Initiation of seed development in absence of fertilization
Function-related keywords:
Literature:
- Expression and parent-of-origin effects for FIS2, MEA, and FIE in the endosperm and embryo of developing Arabidopsis seeds. DOI: 10.1073/pnas.170292997 ; PMID: 10962025
- Seed development: with or without sex? DOI: 10.1016/s0960-9822(99)80411-4 ; PMID: 10508576
- Control of fertilization-independent endosperm development by the MEDEA polycomb gene in Arabidopsis. DOI: 10.1073/pnas.96.7.4186 ; PMID: 10097185
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Interaction of the Arabidopsis polycomb group proteins FIE and MEA mediates their common phenotypes. DOI: 10.1016/s0960-9822(00)00839-3 ; PMID: 11114524
- Polycomb group genes control pattern formation in plant seed. DOI: 10.1016/s0960-9822(01)00072-0 ; PMID: 11250158
- Mutations in the FIE and MEA genes that encode interacting polycomb proteins cause parent-of-origin effects on seed development by distinct mechanisms. DOI: 10.1105/tpc.12.12.2367 ; PMID: 11148284
- Embryo and endosperm development is disrupted in the female gametophytic capulet mutants of Arabidopsis. DOI: 10.1093/genetics/162.4.1911 ; PMID: 12524359
- Duplicated fie genes in maize: expression pattern and imprinting suggest distinct functions. DOI: 10.1105/tpc.006759 ; PMID: 12566582
- The Polycomb-group protein MEDEA regulates seed development by controlling expression of the MADS-box gene PHERES1. DOI: 10.1101/gad.257403 ; PMID: 12815071
- Arabidopsis MSI1 is a component of the MEA/FIE Polycomb group complex and required for seed development. DOI: 10.1093/emboj/cdg444 ; PMID: 12970192
- FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development. DOI: 10.1111/j.1365-313x.2003.01996.x ; PMID: 14871310
- [Genomic imprinting and seed development]. DOI: 0253-9772(2005)04-0665-06 ; PMID: 16120596
- Polycomb group complexes self-regulate imprinting of the Polycomb group gene MEDEA in Arabidopsis. DOI: 10.1016/j.cub.2006.01.020 ; PMID: 16527743
- Dynamic regulatory interactions of Polycomb group genes: MEDEA autoregulation is required for imprinted gene expression in Arabidopsis. DOI: 10.1101/gad.378106 ; PMID: 16651654
- The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. DOI: 10.1073/pnas.0606385103 ; PMID: 16983073
- Deeper into the maize: new insights into genomic imprinting in plants. DOI: 10.1002/bies.20508 ; PMID: 17120227
- Activation of the imprinted Polycomb Group Fie1 gene in maize endosperm requires demethylation of the maternal allele. DOI: 10.1007/s11103-007-9160-0 ; PMID: 17437065
- Vernalization-induced trimethylation of histone H3 lysine 27 at FLC is not maintained in mitotically quiescent cells. DOI: 10.1016/j.cub.2007.10.026 ; PMID: 17980595
- Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. DOI: 10.1105/tpc.108.058891 ; PMID: 18552200
- UBIQUITIN-SPECIFIC PROTEASE 26 is required for seed development and the repression of PHERES1 in Arabidopsis. DOI: 10.1534/genetics.108.091736 ; PMID: 18723879
- Sexual and apomictic seed formation in Hieracium requires the plant polycomb-group gene FERTILIZATION INDEPENDENT ENDOSPERM. DOI: 10.1105/tpc.108.059287 ; PMID: 18812497
- Repression of FLOWERING LOCUS C and FLOWERING LOCUS T by the Arabidopsis Polycomb repressive complex 2 components. DOI: 10.1371/journal.pone.0003404 ; PMID: 18852898
- A dynamic reciprocal RBR-PRC2 regulatory circuit controls Arabidopsis gametophyte development. DOI: 10.1016/j.cub.2008.09.026 ; PMID: 18976913
- Resetting and regulation of Flowering Locus C expression during Arabidopsis reproductive development. DOI: 10.1111/j.1365-313X.2008.03776.x ; PMID: 19121105
- Regulation of imprinted gene expression in Arabidopsis endosperm. DOI: 10.1073/pnas.1019273108 ; PMID: 21257907
- Synergistic repression of the embryonic programme by SET DOMAIN GROUP 8 and EMBRYONIC FLOWER 2 in Arabidopsis seedlings. DOI: 10.1093/jxb/err383 ; PMID: 22162868
- The Armadillo repeat gene ZAK IXIK promotes Arabidopsis early embryo and endosperm development through a distinctive gametophytic maternal effect. DOI: 10.1105/tpc.112.102384 ; PMID: 23064319
- The Polycomb group protein MEDEA and the DNA methyltransferase MET1 interact to repress autonomous endosperm development in Arabidopsis. DOI: 10.1111/tpj.12070 ; PMID: 23146178
- Alterations in seed development gene expression affect size and oil content of Arabidopsis seeds. DOI: 10.1104/pp.113.226761 ; PMID: 24014578
- Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation. DOI: 10.1105/tpc.15.00744 ; PMID: 27650334
- FIE, a nuclear PRC2 protein, forms cytoplasmic complexes in Arabidopsis thaliana. DOI: 10.1093/jxb/erw373 ; PMID: 27811080
- Cis and trans determinants of epigenetic silencing by Polycomb repressive complex 2 in Arabidopsis. DOI: 10.1038/ng.3937 ; PMID: 28825728
- Integration of Transcriptional Repression and Polycomb-Mediated Silencing of WUSCHEL in Floral Meristems. DOI: 10.1105/tpc.18.00450 ; PMID: 31068455
- Genome-wide identification of EMBRYO-DEFECTIVE (EMB) genes required for growth and development in Arabidopsis. DOI: 10.1111/nph.16071 ; PMID: 31334862
- Glucose-driven TOR-FIE-PRC2 signalling controls plant development. DOI: 10.1038/s41586-022-05171-5 ; PMID: 36104568
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Mutations in the FIE and MEA genes that encode interacting polycomb proteins cause parent-of-origin effects on seed development by distinct mechanisms. DOI: 10.1105/tpc.12.12.2367 ; PMID: 11148284
- Arabidopsis DDB1-CUL4 ASSOCIATED FACTOR1 forms a nuclear E3 ubiquitin ligase with DDB1 and CUL4 that is involved in multiple plant developmental processes. DOI: 10.1105/tpc.108.058891 ; PMID: 18552200
- A dynamic reciprocal RBR-PRC2 regulatory circuit controls Arabidopsis gametophyte development. DOI: 10.1016/j.cub.2008.09.026 ; PMID: 18976913
Sequences:
cDNA Sequence
- >AT3G20740.1
AAAGGTGAGTTGTGTGTTGTGTCAGGTCCAAAATAAAAGTTTGTCGTGAGGTCAAAATCTACGGTTACAGTAATTTTAATAACCTGTGAATCTGTGTCTAATCGAAAATTACAAAACACCAGTTGTTGTTGCATGAGAGACTTGTGAGCTTAGATTAGTGTGCGAGAGTCAGACAGAGAGAGAGATTTCGAATATCGAATGTCGAAGATAACCTTAGGGAACGAGTCAATAGTTGGGTCTTTGACTCCATCGAATAAGAAATCGTACAAAGTGACGAATAGGATTCAGGAAGGGAAGAAACCTTTGTATGCTGTTGTTTTCAACTTCCTTGATGCTCGTTTCTTCGATGTCTTCGTTACCGCTGGTGGAAATCGGATTACTCTGTACAATTGTCTCGGAGATGGTGCCATATCAGCATTGCAATCCTATGCTGATGAAGATAAGGAAGAGTCGTTTTACACGGTAAGTTGGGCGTGTGGCGTTAATGGGAACCCATATGTTGCGGCTGGAGGAGTAAAAGGTATAATCCGAGTCATTGACGTCAACAGTGAAACGATTCATAAGAGTCTTGTGGGTCATGGAGATTCAGTGAACGAAATCAGGACACAACCTTTAAAACCTCAACTTGTGATTACTGCTAGCAAGGATGAATCTGTTCGTTTGTGGAATGTTGAAACTGGGATATGTATTTTGATATTTGCTGGAGCTGGAGGTCATCGCTATGAAGTTCTAAGTGTGGATTTTCATCCGTCTGATATTTACCGCTTTGCTAGTTGTGGTATGGACACCACTATTAAAATATGGTCAATGAAAGAGTTTTGGACGTACGTCGAGAAGTCATTCACATGGACTGATGATCCATCAAAATTCCCCACAAAATTTGTCCAATTCCCTGTATTTACAGCTTCCATTCATACAAATTATGTAGATTGTAACCGTTGGTTTGGTGATTTTATCCTCTCAAAGAGTGTGGACAACGAGATCCTGTTGTGGGAACCACAACTGAAAGAGAATTCTCCTGGCGAGGGAGCTTCAGATGTTCTATTAAGATACCCGGTTCCAATGTGTGATATTTGGTTTATCAAGTTTTCTTGTGACCTCCATTTAAGTTCTGTTGCGATAGGTAATCAGGAAGGAAAGGTTTATGTCTGGGATTTGAAAAGTTGCCCTCCTGTTTTGATTACAAAGTTATCACACAATCAATCAAAGTCTGTAATCAGGCAAACAGCCATGTCTGTCGATGGAAGCACGATTCTTGCTTGCTGCGAGGACGGGACTATATGGCGCTGGGACGTGATTACCAAGTAGCGGTCTGAGTCTTGTAGGAATTGATGAATTAGGAGTGCGAAGAAATGAGATATCCATTCTTTTATTGTAATTCTGATCATGTTGCTACTCCCTGAGACCTTGAGATGCTCTTTGTAGCCTTGTTAACGTCCACCCTTGTACCACAGTGTATACCCTTTCTGGAGATTTTGTCTTATTCTCTTAGTTCAATACACAAGGCTGTATCCTGGAGCTTTATTGCAGGAACCACTCTCTTTCATAAGCTTTCTAGTATTC
CDS Sequence
- >AT3G20740.1
ATGTCGAAGATAACCTTAGGGAACGAGTCAATAGTTGGGTCTTTGACTCCATCGAATAAGAAATCGTACAAAGTGACGAATAGGATTCAGGAAGGGAAGAAACCTTTGTATGCTGTTGTTTTCAACTTCCTTGATGCTCGTTTCTTCGATGTCTTCGTTACCGCTGGTGGAAATCGGATTACTCTGTACAATTGTCTCGGAGATGGTGCCATATCAGCATTGCAATCCTATGCTGATGAAGATAAGGAAGAGTCGTTTTACACGGTAAGTTGGGCGTGTGGCGTTAATGGGAACCCATATGTTGCGGCTGGAGGAGTAAAAGGTATAATCCGAGTCATTGACGTCAACAGTGAAACGATTCATAAGAGTCTTGTGGGTCATGGAGATTCAGTGAACGAAATCAGGACACAACCTTTAAAACCTCAACTTGTGATTACTGCTAGCAAGGATGAATCTGTTCGTTTGTGGAATGTTGAAACTGGGATATGTATTTTGATATTTGCTGGAGCTGGAGGTCATCGCTATGAAGTTCTAAGTGTGGATTTTCATCCGTCTGATATTTACCGCTTTGCTAGTTGTGGTATGGACACCACTATTAAAATATGGTCAATGAAAGAGTTTTGGACGTACGTCGAGAAGTCATTCACATGGACTGATGATCCATCAAAATTCCCCACAAAATTTGTCCAATTCCCTGTATTTACAGCTTCCATTCATACAAATTATGTAGATTGTAACCGTTGGTTTGGTGATTTTATCCTCTCAAAGAGTGTGGACAACGAGATCCTGTTGTGGGAACCACAACTGAAAGAGAATTCTCCTGGCGAGGGAGCTTCAGATGTTCTATTAAGATACCCGGTTCCAATGTGTGATATTTGGTTTATCAAGTTTTCTTGTGACCTCCATTTAAGTTCTGTTGCGATAGGTAATCAGGAAGGAAAGGTTTATGTCTGGGATTTGAAAAGTTGCCCTCCTGTTTTGATTACAAAGTTATCACACAATCAATCAAAGTCTGTAATCAGGCAAACAGCCATGTCTGTCGATGGAAGCACGATTCTTGCTTGCTGCGAGGACGGGACTATATGGCGCTGGGACGTGATTACCAAGTAG
Protein Sequence
- >AT3G20740.1
MSKITLGNESIVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFDVFVTAGGNRITLYNCLGDGAISALQSYADEDKEESFYTVSWACGVNGNPYVAAGGVKGIIRVIDVNSETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNVETGICILIFAGAGGHRYEVLSVDFHPSDIYRFASCGMDTTIKIWSMKEFWTYVEKSFTWTDDPSKFPTKFVQFPVFTASIHTNYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGASDVLLRYPVPMCDIWFIKFSCDLHLSSVAIGNQEGKVYVWDLKSCPPVLITKLSHNQSKSVIRQTAMSVDGSTILACCEDGTIWRWDVITK