Information report for AT3G20600
Gene Details
|
|
Functional Descriptions
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0000014 — rosette leaf — hoja en roseta (Spanish, exact), ロゼット葉 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- CS6355 — ndr1-1 blocks reactive oxygen-dependent induction of salicylic acid biosynthesis, producing race non-specific effects on disease resistance and race-specific effects on systemic acquired resistance (SAR), pathogenesis-related (PR) gene expression and the hypersensitive response (HR); no visible phenotype. npr1-2 blocks negative feedback on the hypersensitive response (HR); reduced expression of pathogenesis-related (PR) genes in response to salicylic acid; enhanced susceptibility to the virulent bacterial pathogen Pseudomonas syringae pv. maculicola strain ES4326; no visible phenotype
- CS6356 — ndr1-1 blocks reactive oxygen-dependent induction of salicylic acid biosynthesis, producing race non-specific effects on disease resistance and race-specific effects on systemic acquired resistance (SAR), pathogenesis-related (PR) gene expression and the hypersensitive response (HR); no visible phenotype. npr1-2 blocks negative feedback on the hypersensitive response (HR); reduced expression of pathogenesis-related (PR) genes in response to salicylic acid; enhanced susceptibility to the virulent bacterial pathogen Pseudomonas syringae pv. maculicola strain ES4326; no visible phenotype; null allele.gl1 lacks trichomes on leaves and stems.
- CS6358 — No visible phenotype.
- CS68768 — Susceptible to bacterial pathogen Pseudomonas syringae pv. tomato DC3000 (Pto DC3000) carrying the avirulence gene avrRpm1. Full loss of Pst DC3000(avrRpm1)-triggered HR.
- CS68771 — Susceptible to Pseudomonas syringae pv tomato (Pst) DC3000(avrRpm1). Severe reduction of DC3000(avrRpm1)-induced hypersensitive response.
- CS68793 — No visible phenotype.
- CS73287 — dwarfed; leaves exhibit visible lesions of dead cells
- CS73288 — dwarfed; leaves exhibit visible lesions of dead cells
- CS73290 — dwarfed
- ndr1 — Susceptibility to variety of pathogens
Functional Keywords
- cauline leaf , rosette leaf , root , stem
Literature and News
- Downy mildew (Peronospora parasitica) resistance genes in Arabidopsis vary in functional requirements for NDR1, EDS1, NPR1 and salicylic acid accumulation. DOI: 10.1046/j.1365-313x.2000.00771.x ; PMID: 10886772
- Different requirements for EDS1 and NDR1 by disease resistance genes define at least two R gene-mediated signaling pathways in Arabidopsis. DOI: 10.1073/pnas.95.17.10306 ; PMID: 9707643
- The role of NDR1 in avirulence gene-directed signaling and control of programmed cell death in Arabidopsis. DOI: 6881 ; PMID: 11706189
- Arabidopsis RPP4 is a member of the RPP5 multigene family of TIR-NB-LRR genes and confers downy mildew resistance through multiple signalling components. DOI: 10.1046/j.0960-7412.2001.01229.x ; PMID: 11846877
- Environmentally sensitive, SA-dependent defense responses in the cpr22 mutant of Arabidopsis. DOI: 10.1046/j.1365-313x.2001.2641039.x ; PMID: 11439131
- The Arabidopsis downy mildew resistance gene, RPP13-Nd, functions independently of NDR1 and EDS1 and does not require the accumulation of salicylic acid. DOI: 10.1094/MPMI.2001.14.3.416 ; PMID: 11277440
- Differential expression of genes encoding Arabidopsis phospholipases after challenge with virulent or avirulent Pseudomonas isolates. DOI: 10.1094/MPMI.2002.15.8.808 ; PMID: 12182338
- NPP1, a Phytophthora-associated trigger of plant defense in parsley and Arabidopsis. DOI: 10.1046/j.1365-313x.2002.01454.x ; PMID: 12410815
- An investigation into the involvement of defense signaling pathways in components of the nonhost resistance of Arabidopsis thaliana to rust fungi also reveals a model system for studying rust fungal compatibility. DOI: 10.1094/MPMI.2003.16.5.398 ; PMID: 12744510
- Capillary electrophoresis-based profiling and quantitation of total salicylic acid and related phenolics for analysis of early signaling in Arabidopsis disease resistance. DOI: 10.1016/s0003-2697(03)00405-6 ; PMID: 12927828
- Up-regulation of Arabidopsis thaliana NHL10 in the hypersensitive response to Cucumber mosaic virus infection and in senescing leaves is controlled by signalling pathways that differ in salicylate involvement. DOI: 10.1007/s00425-003-1169-2 ; PMID: 14666423
- Sensitization of defense responses and activation of programmed cell death by a pathogen-induced receptor-like protein kinase in Arabidopsis. DOI: 10.1023/B:PLAN.0000009265.72567.58 ; PMID: 14756307
- Feedback control of the Arabidopsis hypersensitive response. DOI: 10.1094/MPMI.2004.17.4.357 ; PMID: 15077668
- High humidity suppresses ssi4-mediated cell death and disease resistance upstream of MAP kinase activation, H2O2 production and defense gene expression. DOI: 10.1111/j.1365-313X.2004.02180.x ; PMID: 15341634
- Two pathways act in an additive rather than obligatorily synergistic fashion to induce systemic acquired resistance and PR gene expression. DOI: 10.1186/1471-2229-2-9 ; PMID: 12381270
- The atypical resistance gene, RPW8, recruits components of basal defence for powdery mildew resistance in Arabidopsis. DOI: 10.1111/j.1365-313X.2005.02356.x ; PMID: 15773856
- Role of salicylic acid and fatty acid desaturation pathways in ssi2-mediated signaling. DOI: 10.1104/pp.105.071662 ; PMID: 16306139
- Genetic analysis of developmentally regulated resistance to downy mildew (Hyaloperonospora parasitica) in Arabidopsis thaliana. DOI: 10.1094/MPMI-18-1226 ; PMID: 16353557
- The chimeric Arabidopsis CYCLIC NUCLEOTIDE-GATED ION CHANNEL11/12 activates multiple pathogen resistance responses. DOI: 10.1105/tpc.105.038786 ; PMID: 16461580
- Early responses in the Arabidopsis-Verticillium longisporum pathosystem are and ET-associated signals via cytosolic NPR1 and RFO1. DOI: 10.1094/MPMI-19-0958 ; PMID: 16941900
- A high-performance, small-scale microarray for expression profiling of many samples in Arabidopsis-pathogen studies. DOI: 10.1111/j.1365-313X.2006.02972.x ; PMID: 17181774
- Salicylic acid-mediated innate immunity in Arabidopsis is regulated by SIZ1 SUMO E3 ligase. DOI: 10.1111/j.1365-313X.2006.02947.x ; PMID: 17163880
- Discovery of ADP-ribosylation and other plant defense pathway elements through expression profiling of four different Arabidopsis-Pseudomonas R-avr interactions. DOI: 10.1094/MPMI-21-5-0646 ; PMID: 18393624
- Signaling pathways that regulate the enhanced disease resistance of Arabidopsis "defense, no death" mutants. DOI: 10.1094/MPMI-21-10-1285 ; PMID: 18785824
- The genetic network controlling the Arabidopsis transcriptional response to Pseudomonas syringae pv. maculicola: roles of major regulators and the phytotoxin coronatine. DOI: 10.1094/MPMI-21-11-1408 ; PMID: 18842091
- The Pseudomonas syringae type III effector AvrRpm1 induces significant defenses by activating the Arabidopsis nucleotide-binding leucine-rich repeat protein RPS2. DOI: 10.1111/j.1365-313X.2008.03716.x ; PMID: 18980653
- A pathogen-inducible endogenous siRNA in plant immunity. DOI: 10.1073/pnas.0608258103 ; PMID: 17071740
- An F-box gene, CPR30, functions as a negative regulator of the defense response in Arabidopsis. DOI: 10.1111/j.1365-313X.2009.03995.x ; PMID: 19682297
- A lesion-mimic syntaxin double mutant in Arabidopsis reveals novel complexity of pathogen defense signaling. DOI: 10.1093/mp/ssn011 ; PMID: 19825557
- Activation of plant immune responses by a gain-of-function mutation in an atypical receptor-like kinase. DOI: 10.1104/pp.110.158501 ; PMID: 20508139
- A mutant CHS3 protein with TIR-NB-LRR-LIM domains modulates growth, cell death and freezing tolerance in a temperature-dependent manner in Arabidopsis. DOI: 10.1111/j.1365-313X.2010.04241.x ; PMID: 20444230
- Enhanced disease susceptibility 1 and salicylic acid act redundantly to regulate resistance gene-mediated signaling. DOI: 10.1371/journal.pgen.1000545 ; PMID: 19578402
- Effector-triggered innate immunity contributes Arabidopsis resistance to Xanthomonas campestris. DOI: 10.1111/j.1364-3703.2010.00642.x ; PMID: 21029323
- Proline induces calcium-mediated oxidative burst and salicylic acid signaling. DOI: 10.1007/s00726-010-0757-2 ; PMID: 20890619
- Arabidopsis NDR1 is an integrin-like protein with a role in fluid loss and plasma membrane-cell wall adhesion. DOI: 10.1104/pp.110.169656 ; PMID: 21398259
- Interfamily transfer of tomato Ve1 mediates Verticillium resistance in Arabidopsis. DOI: 10.1104/pp.111.180067 ; PMID: 21617027
- Computational prediction and molecular characterization of an oomycete effector and the cognate Arabidopsis resistance gene. DOI: 10.1371/journal.pgen.1002502 ; PMID: 22359513
- SR1, a calmodulin-binding transcription factor, modulates plant defense and ethylene-induced senescence by directly regulating NDR1 and EIN3. DOI: 10.1104/pp.111.192310 ; PMID: 22345509
- EDS1 contributes to nonhost resistance of Arabidopsis thaliana against Erwinia amylovora. DOI: 10.1094/MPMI-05-11-0111 ; PMID: 22316300
- Priming of the Arabidopsis pattern-triggered immunity response upon infection by necrotrophic Pectobacterium carotovorum bacteria. DOI: 10.1111/j.1364-3703.2012.00827.x ; PMID: 22947164
- A missense mutation in CHS1, a TIR-NB protein, induces chilling sensitivity in Arabidopsis. DOI: 10.1111/tpj.12232 ; PMID: 23651299
- Overexpression of a citrus NDR1 ortholog increases disease resistance in Arabidopsis. DOI: 10.3389/fpls.2013.00157 ; PMID: 23761797
- The synthetic cationic lipid diC14 activates a sector of the Arabidopsis defence network requiring endogenous signalling components. DOI: 10.1111/mpp.12252 ; PMID: 25727690
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Rutin-Mediated Priming of Plant Resistance to Three Bacterial Pathogens Initiating the Early SA Signal Pathway. DOI: 10.1371/journal.pone.0146910 ; PMID: 26751786
- Phylogeny of Plant CAMTAs and Role of AtCAMTAs in Nonhost Resistance to Xanthomonas oryzae pv. oryzae. DOI: 10.3389/fpls.2016.00177 ; PMID: 26973658
- The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. DOI: 10.1104/pp.16.00008 ; PMID: 28250067
- Arabidopsis defense mutant ndr1-1 displays accelerated development and early flowering mediated by the hormone gibberellic acid. DOI: 10.1016/j.plantsci.2019.04.006 ; PMID: 31203885
- Arabidopsis CBP60b is a central transcriptional activator of immunity. DOI: 10.1093/plphys/kiab164 ; PMID: 33848345
- Ammonium-mediated reduction in salicylic acid content and recovery of plant growth in Arabidopsis siz1 mutants is modulated by NDR1 and NPR1. DOI: 10.1080/15592324.2021.1928819 ; PMID: 33989128
- The Mechanosensitive Ion Channel MSL10 Modulates Susceptibility to Pseudomonas syringae in Arabidopsis thaliana. DOI: 10.1094/MPMI-08-21-0207-FI ; PMID: 34775835
- MPK3 and MPK6 control salicylic acid signaling by up-regulating NLR receptors and effector-triggered immunity. DOI: 10.1093/jxb/erab544 ; PMID: 35032388
Gene Resources
- UniProt: A0A654FEF3
- EMBL: CACRSJ010000106
- AlphaFoldDB: A0A654FEF3
- EnsemblPlants: AT3G20600.1
- Gramene: AT3G20600.1
- KEGG: ath:AT3G20600
- Orthologous matrix: KSMAPRM
- ExpressionAtlas: AT3G20600
- InterPro: IPR044839
- PANTHER: PTHR31415, PTHR31415:SF52
Homologs
- Glycine max GmSYP24
- Solanum tuberosum Soltu.DM.02G019710
Sequences
cDNA Sequence
- >AT3G20600.1
TTTTGAGTCAACTTGAAATATCAACCAATCAGCAAACCAAAATCTTATAACATCATCTTCTTCATCTTTCCGACAAAAATACCAAATTCTTGAAAACAAAAAAAAAATGAATAATCAAAATGAAGACACAGAAGGTGGTCGAAACTGTTGTACTTGCTGCTTAAGCTTCATCTTCACAGCTGGTCTCACCTCTCTTTTCTTATGGCTTAGTCTCCGTGCGGACAAACCCAAATGCTCAATCCAAAACTTTTTCATTCCTGCCCTCGGAAAAGACCCAAATTCACGAGACAATACCACTCTAAATTTCATGGTTCGTTGTGACAATCCGAATAAAGACAAAGGAATCTACTACGACGATGTCCACCTTAATTTTTCCACCATCAACACGACCAAGATCAATTCATCTGCTCTTGTCTTAGTTGGTAACTACACAGTGCCTAAGTTCTATCAAGGACACAAGAAGAAGGCCAAGAAGTGGGGTCAAGTAAAGCCGCTAAACAACCAGACGGTTTTACGAGCGGTTTTGCCTAATGGATCGGCTGTTTTCAGGTTGGATCTCAAGACTCAAGTTAGATTCAAGATTGTTTTTTGGAAAACTAAGAGGTATGGGGTTGAAGTTGGAGCTGATGTTGAAGTCAACGGTGATGGAGTTAAAGCTCAGAAGAAAGGAATTAAGATGAAGAAATCTGATTCTTCTTTTCCATTAAGAAGCTCTTTTCCGATTAGTGTTTTGATGAATTTACTCGTATTCTTTGCTATTCGTTAACTTCATTAATGGTGTTGATTTTCAGGTTTTTCATTTCTTGGTTTTGTTGATTTTGATTATTGACTATTTCATGAGTTTTGTTGTGATCCTTAGTTCCATTTTCTTCATTGCATAATTTATCCCTTATTTTTTTTGTTTTAACTATGTATTAGTTTCCATCAACAAAATTCTATTTGAAAATCATTTTATCCATTTTTTATATGTACAAGAAACAATTATATGTTGGGTTTCAA
CDS Sequence
- >AT3G20600.1
ATGAATAATCAAAATGAAGACACAGAAGGTGGTCGAAACTGTTGTACTTGCTGCTTAAGCTTCATCTTCACAGCTGGTCTCACCTCTCTTTTCTTATGGCTTAGTCTCCGTGCGGACAAACCCAAATGCTCAATCCAAAACTTTTTCATTCCTGCCCTCGGAAAAGACCCAAATTCACGAGACAATACCACTCTAAATTTCATGGTTCGTTGTGACAATCCGAATAAAGACAAAGGAATCTACTACGACGATGTCCACCTTAATTTTTCCACCATCAACACGACCAAGATCAATTCATCTGCTCTTGTCTTAGTTGGTAACTACACAGTGCCTAAGTTCTATCAAGGACACAAGAAGAAGGCCAAGAAGTGGGGTCAAGTAAAGCCGCTAAACAACCAGACGGTTTTACGAGCGGTTTTGCCTAATGGATCGGCTGTTTTCAGGTTGGATCTCAAGACTCAAGTTAGATTCAAGATTGTTTTTTGGAAAACTAAGAGGTATGGGGTTGAAGTTGGAGCTGATGTTGAAGTCAACGGTGATGGAGTTAAAGCTCAGAAGAAAGGAATTAAGATGAAGAAATCTGATTCTTCTTTTCCATTAAGAAGCTCTTTTCCGATTAGTGTTTTGATGAATTTACTCGTATTCTTTGCTATTCGTTAA
Protein Sequence
- >AT3G20600.1
MNNQNEDTEGGRNCCTCCLSFIFTAGLTSLFLWLSLRADKPKCSIQNFFIPALGKDPNSRDNTTLNFMVRCDNPNKDKGIYYDDVHLNFSTINTTKINSSALVLVGNYTVPKFYQGHKKKAKKWGQVKPLNNQTVLRAVLPNGSAVFRLDLKTQVRFKIVFWKTKRYGVEVGADVEVNGDGVKAQKKGIKMKKSDSSFPLRSSFPISVLMNLLVFFAIR