Gene Details:
- Gene ID: AT3G17390
- Gene Symbol: AtSAMS3, MAT4, MTO3, SAMS3
- Gene Name: METHIONINE ADENOSYLTRANSFERASE 4, METHIONINE OVER-ACCUMULATOR 3, S-ADENOSYLMETHIONINE SYNTHETASE 3
- Description: S-adenosylmethionine synthetase family protein;(source:Araport11)
- TAIR Accession: locus:2089070
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0000282 — trichome — tricoma (Spanish, exact), 毛茸、糸状体、毛 (Japanese, exact), seta (related), setae (related), capilli (narrow), capillus (narrow), cilia (narrow), cilium (narrow), glochid (narrow), glochidia (narrow), glochidium (narrow), hair (narrow), lepides (narrow), lepis (narrow), non-secretory trichome (narrow), scale (narrow), squama (narrow), squamae (narrow), squamella (narrow), squamellae (narrow), squamule (narrow), barb trichome (broad), bristle (broad)
- PO:0000084 — plant sperm cell — célula espermática o esperma (Spanish, exact), male gamete (exact), microgamete (exact), 植物精子細胞 (Japanese, exact), sperm nucleus (related), sperm cell (broad)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
Gene Ontology:
- GO:0003729 — enables — mRNA binding
- GO:0009809 — acts upstream of or within — lignin biosynthetic process
- GO:0005737 — located in — cytoplasm
- GO:0005886 — located in — plasma membrane
- GO:0006556 — involved in — S-adenosylmethionine biosynthetic process
- GO:0006555 — acts upstream of or within — methionine metabolic process
- GO:0009506 — located in — plasmodesma
- GO:0004478 — enables — methionine adenosyltransferase activity
- GO:0009409 — acts upstream of or within — response to cold
- GO:0009505 — located in — plant-type cell wall
- GO:0005829 — located in — cytosol
- GO:0005829 — is active in — cytosol
- GO:0005730 — located in — nucleolus
Germplasm Phenotype:
- mto3 — Excessive methionine
Function-related keywords:
Literature:
- Transcriptome analysis of sulfur depletion in Arabidopsis thaliana: interlacing of biosynthetic pathways provides response specificity. DOI: 10.1046/j.1365-313x.2003.01657.x ; PMID: 12609038
- Post-genomics approaches for the elucidation of plant adaptive mechanisms to sulphur deficiency. DOI: 10.1093/jxb/erh184 ; PMID: 15208337
- Cell-specific protein profiling in Arabidopsis thaliana trichomes: identification of trichome-located proteins involved in sulfur metabolism and detoxification. DOI: 10.1016/j.phytochem.2004.03.026 ; PMID: 15276459
- The potassium-dependent transcriptome of Arabidopsis reveals a prominent role of jasmonic acid in nutrient signaling. DOI: 10.1104/pp.104.046482 ; PMID: 15347784
- Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions. DOI: 10.1091/mbc.e04-09-0791 ; PMID: 15496452
- Extracellular ATP functions as an endogenous external metabolite regulating plant cell viability. DOI: 10.1105/tpc.105.036806 ; PMID: 16199612
- Overexpression of AtCpNifS enhances selenium tolerance and accumulation in Arabidopsis. DOI: 10.1104/pp.105.068684 ; PMID: 16244144
- Differential inhibition of Arabidopsis methionine adenosyltransferases by protein S-nitrosylation. DOI: 10.1074/jbc.M511635200 ; PMID: 16365035
- Dynamics of Arabidopsis thaliana soluble proteome in response to different nutrient culture conditions. DOI: 10.1002/elps.200500561 ; PMID: 16358359
- Proteomic analysis and extensive protein identification from dry, germinating Arabidopsis seeds and young seedlings. DOI: 10.5483/bmbrep.2005.38.6.650 ; PMID: 16336779
- Towards the proteome of Brassica napus phloem sap. DOI: 10.1002/pmic.200500155 ; PMID: 16400686
- Proteome analysis of cold stress response in Arabidopsis thaliana using DIGE-technology. DOI: 10.1093/jxb/erj129 ; PMID: 16574749
- Effect of sulfur availability on the integrity of amino acid biosynthesis in plants. DOI: 10.1007/s00726-005-0251-4 ; PMID: 16552493
- Proteomic investigation of the effect of salicylic acid on Arabidopsis seed germination and establishment of early defense mechanisms. DOI: 10.1104/pp.106.082057 ; PMID: 16679420
- Exploiting the wild crucifer Thlaspi arvense to identify conserved and novel genes expressed during a plant's response to cold stress. DOI: 10.1007/s11103-006-9080-4 ; PMID: 16972165
- Principal transcriptional programs regulating plant amino acid metabolism in response to abiotic stresses. DOI: 10.1104/pp.108.115733 ; PMID: 18375600
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Quantitative proteomics of a chloroplast SRP54 sorting mutant and its genetic interactions with CLPC1 in Arabidopsis. DOI: 10.1104/pp.108.124545 ; PMID: 18633119
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- The relative contribution of genes operating in the S-methylmethionine cycle to methionine metabolism in Arabidopsis seeds. DOI: 10.1007/s00299-017-2124-1 ; PMID: 28289884
- METHIONINE ADENOSYLTRANSFERASE4 Mediates DNA and Histone Methylation. DOI: 10.1104/pp.18.00183 ; PMID: 29572390
- Protein and metabolite composition of Arabidopsis stress granules. DOI: 10.1111/nph.15690 ; PMID: 30664249
- Discovering the RNA-Binding Proteome of Plant Leaves with an Improved RNA Interactome Capture Method. DOI: 10.3390/biom10040661 ; PMID: 32344669
- Cell-specific protein profiling in Arabidopsis thaliana trichomes: identification of trichome-located proteins involved in sulfur metabolism and detoxification. DOI: 10.1016/j.phytochem.2004.03.026 ; PMID: 15276459
- Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions. DOI: 10.1091/mbc.e04-09-0791 ; PMID: 15496452
- Arabidopsis cell wall proteome defined using multidimensional protein identification technology. DOI: 10.1002/pmic.200500046 ; PMID: 16287169
- Proteome analysis of cold stress response in Arabidopsis thaliana using DIGE-technology. DOI: 10.1093/jxb/erj129 ; PMID: 16574749
- Quantitative phosphoproteomics of early elicitor signaling in Arabidopsis. DOI: 10.1074/mcp.M600429-MCP200 ; PMID: 17317660
- Membrane proteomic analysis of Arabidopsis thaliana using alternative solubilization techniques. DOI: 10.1021/pr060525b ; PMID: 17432890
- A high content in lipid-modified peripheral proteins and integral receptor kinases features in the arabidopsis plasma membrane proteome. DOI: 10.1074/mcp.M700099-MCP200 ; PMID: 17644812
- Analysis of the Arabidopsis cytosolic proteome highlights subcellular partitioning of central plant metabolism. DOI: 10.1021/pr1009433 ; PMID: 21166475
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Sequences:
cDNA Sequence
- >AT3G17390.1
CAGATATCTAGATCTCATTGTCTGAACACAGTTAGATGAAACTGGGAATGAATCTGGACGAAATTACGATCTTACACCAACCCCCTCGACGAGCTCGTATATATAAAGCTTATACGCTCCTCCTTCACCTTCGTACTACTACTACCACCACATTTCTTTAGCTCAACCTTCATTACTAATCTCCTTTTAAGGTTTCTTTCGTGAATCAGATCGGAAAAATGGAATCTTTTTTGTTCACATCTGAATCCGTCAACGAGGGACATCCCGACAAGCTTTGTGATCAGATCTCCGACGCTATCCTCGATGCTTGCCTTGAACAAGACCCTGAGAGCAAAGTTGCTTGTGAGACTTGTACCAAGACTAACATGGTCATGGTTTTTGGAGAAATCACCACCAAGGCTAACGTTGATTACGAGCAGATTGTTCGTAAAACATGCCGTGAGATTGGATTCGTCTCTGCTGACGTTGGTCTAGATGCTGACAATTGCAAGGTTCTGGTTAACATTGAGCAACAGAGTCCTGACATTGCACAAGGTGTTCATGGTCATCTCACCAAGAAGCCAGAGGAGGTTGGAGCTGGTGACCAAGGTCACATGTTTGGGTATGCTACTGATGAGACTCCTGAGCTCATGCCTCTTACTCACGTTCTCGCTACTAAGCTTGGAGCTAAACTCACTGAAGTTCGCAAGAATGGAACTTGCCCTTGGTTGAGGCCAGATGGTAAGACTCAAGTCACTATTGAGTACATCAACGAAAGCGGAGCCATGGTTCCTGTACGTGTCCACACTGTTCTCATCTCAACACAGCATGACGAGACTGTGACTAACGATGAGATCGCAGCTGATCTTAAGGAGCATGTGATCAAGCCAGTGATCCCAGAGAAATACCTTGATGAGAAAACCATCTTCCATCTCAACCCATCTGGTCGTTTTGTTATCGGAGGTCCTCATGGAGATGCAGGGCTTACCGGCCGTAAGATCATCATCGATACTTATGGTGGTTGGGGTGCACACGGAGGTGGTGCTTTCTCTGGAAAGGACCCAACCAAGGTTGACAGGAGTGGGGCTTACATCGTTAGGCAAGCAGCTAAGAGCATTGTAGCCAGTGGGCTAGCGAGGCGGGTCATTGTGCAAGTCTCGTATGCCATTGGTGTCCCTGAGCCATTGTCTGTGTTCGTGGACAGTTATGGAACAGGAAAGATACCAGACAAGGAGATTCTTGAGATTGTGAAGGAGAGTTTTGATTTCAGGCCAGGTATGATCTCCATTAACTTGGATCTGAAGAGAGGAGGTAATGGTAGGTTCTTGAAGACTGCTGCCTATGGTCACTTTGGAAGGGACGATGCTGATTTCACCTGGGAGGTAGTCAAGCCACTCAAGTCTAACAAGGTCCAAGCTTGAAACCTGTCAGCCTCTGTTTCACTTCTGTCCAGAATCAGTCTTGTTCTCTGTATTTTAGGCTCTTTCTGCCTCTTTAGTTTCAACTCTGAGATGGGTTTATTCATTTTGTTTTCAACTTTGAAGAAAAAAGCTAAGCAGCTGGGAATTTATATAATTATTTATATGGTATTCTTGTGCTAAGAAAGTTAAATTCATAATATGTATTTCTTACTTATTTTGAGAAGAAAATCATATAAGAGAATAATATTCGACATTAGTCTCCTTTGTTTGCATTATCAATATCAAATATTTTGGCTT
CDS Sequence
- >AT3G17390.1
ATGGAATCTTTTTTGTTCACATCTGAATCCGTCAACGAGGGACATCCCGACAAGCTTTGTGATCAGATCTCCGACGCTATCCTCGATGCTTGCCTTGAACAAGACCCTGAGAGCAAAGTTGCTTGTGAGACTTGTACCAAGACTAACATGGTCATGGTTTTTGGAGAAATCACCACCAAGGCTAACGTTGATTACGAGCAGATTGTTCGTAAAACATGCCGTGAGATTGGATTCGTCTCTGCTGACGTTGGTCTAGATGCTGACAATTGCAAGGTTCTGGTTAACATTGAGCAACAGAGTCCTGACATTGCACAAGGTGTTCATGGTCATCTCACCAAGAAGCCAGAGGAGGTTGGAGCTGGTGACCAAGGTCACATGTTTGGGTATGCTACTGATGAGACTCCTGAGCTCATGCCTCTTACTCACGTTCTCGCTACTAAGCTTGGAGCTAAACTCACTGAAGTTCGCAAGAATGGAACTTGCCCTTGGTTGAGGCCAGATGGTAAGACTCAAGTCACTATTGAGTACATCAACGAAAGCGGAGCCATGGTTCCTGTACGTGTCCACACTGTTCTCATCTCAACACAGCATGACGAGACTGTGACTAACGATGAGATCGCAGCTGATCTTAAGGAGCATGTGATCAAGCCAGTGATCCCAGAGAAATACCTTGATGAGAAAACCATCTTCCATCTCAACCCATCTGGTCGTTTTGTTATCGGAGGTCCTCATGGAGATGCAGGGCTTACCGGCCGTAAGATCATCATCGATACTTATGGTGGTTGGGGTGCACACGGAGGTGGTGCTTTCTCTGGAAAGGACCCAACCAAGGTTGACAGGAGTGGGGCTTACATCGTTAGGCAAGCAGCTAAGAGCATTGTAGCCAGTGGGCTAGCGAGGCGGGTCATTGTGCAAGTCTCGTATGCCATTGGTGTCCCTGAGCCATTGTCTGTGTTCGTGGACAGTTATGGAACAGGAAAGATACCAGACAAGGAGATTCTTGAGATTGTGAAGGAGAGTTTTGATTTCAGGCCAGGTATGATCTCCATTAACTTGGATCTGAAGAGAGGAGGTAATGGTAGGTTCTTGAAGACTGCTGCCTATGGTCACTTTGGAAGGGACGATGCTGATTTCACCTGGGAGGTAGTCAAGCCACTCAAGTCTAACAAGGTCCAAGCTTGA
Protein Sequence
- >AT3G17390.1
MESFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEQIVRKTCREIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEVGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNGTCPWLRPDGKTQVTIEYINESGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRVIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILEIVKESFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKSNKVQA