Information report for AT3G16770
Gene Details
|
|
Functional Descriptions
- GO:0005634 — located in — nucleus
- GO:0003677 — enables — DNA binding
- GO:0009753 — involved in — response to jasmonic acid
- GO:0009723 — involved in — response to ethylene
- GO:0045893 — acts upstream of or within — positive regulation of DNA-templated transcription
- GO:0009873 — acts upstream of or within — ethylene-activated signaling pathway
- GO:0000976 — enables — transcription cis-regulatory region binding
- GO:0003700 — enables — DNA-binding transcription factor activity
- GO:0006355 — acts upstream of or within — regulation of DNA-templated transcription
- GO:0010286 — acts upstream of or within — heat acclimation
- GO:0005515 — enables — protein binding
- GO:0051707 — acts upstream of or within — response to other organism
- GO:0012501 — acts upstream of or within — programmed cell death
- GO:0009735 — acts upstream of or within — response to cytokinin
- GO:0005737 — located in — cytoplasm
- GO:0009723 — acts upstream of or within — response to ethylene
- GO:0005886 — located in — plasma membrane
Functional Keywords
Literature and News
- The AP2 domain of APETALA2 defines a large new family of DNA binding proteins in Arabidopsis. DOI: 10.1073/pnas.94.13.7076 ; PMID: 9192694
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades. DOI: 10.1111/j.1365-313X.2005.02530.x ; PMID: 16212609
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- An Elicitor from Botrytis cinerea Induces the Hypersensitive Response in Arabidopsis thaliana and Other Plants and Promotes the Gray Mold Disease. DOI: 10.1094/PHYTO-96-0299 ; PMID: 18944445
- Disturbance of the Ca(2+)/calmodulin-dependent signalling pathway is responsible for the resistance of Arabidopsis dnd1 against Pectobacterium carotovorum infection. DOI: 10.1111/j.1364-3703.2007.00428.x ; PMID: 20507535
- Protein interactors of acyl-CoA-binding protein ACBP2 mediate cadmium tolerance in Arabidopsis. DOI: 10.4161/psb.5.8.12294 ; PMID: 20657176
- Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. DOI: 10.1186/1471-2229-13-229 ; PMID: 24377444
- Root defense analysis against Fusarium oxysporum reveals new regulators to confer resistance. DOI: 10.1038/srep05584 ; PMID: 24998294
- Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners. DOI: 10.1104/pp.114.244723 ; PMID: 25118255
- Promoter-based integration in plant defense regulation. DOI: 10.1104/pp.114.248716 ; PMID: 25352272
- An Arabidopsis gene regulatory network for secondary cell wall synthesis. DOI: 10.1038/nature14099 ; PMID: 25533953
- The low oxygen, oxidative and osmotic stress responses synergistically act through the ethylene response factor VII genes RAP2.12, RAP2.2 and RAP2.3. DOI: 10.1111/tpj.12848 ; PMID: 25847219
- Constitutively expressed ERF-VII transcription factors redundantly activate the core anaerobic response in Arabidopsis thaliana. DOI: 10.1016/j.plantsci.2015.03.008 ; PMID: 26025519
- Dominant gain-of-function mutations in transmembrane domain III of ERS1 and ETR1 suggest a novel role for this domain in regulating the magnitude of ethylene response in Arabidopsis. DOI: 10.1111/nph.13466 ; PMID: 25988998
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Redundant ERF-VII Transcription Factors Bind to an Evolutionarily Conserved cis-Motif to Regulate Hypoxia-Responsive Gene Expression in Arabidopsis. DOI: 10.1105/tpc.15.00866 ; PMID: 26668304
- Ethylene response factor AtERF72 negatively regulates Arabidopsis thaliana response to iron deficiency. DOI: 10.1016/j.bbrc.2017.04.014 ; PMID: 28390898
- ERF-VII members exhibit synergistic and separate roles in Arabidopsis. DOI: 10.1080/15592324.2017.1329073 ; PMID: 28537474
- ERF72 interacts with ARF6 and BZR1 to regulate hypocotyl elongation in Arabidopsis. DOI: 10.1093/jxb/ery220 ; PMID: 29897568
- Genetic interactions between ABA signalling and the Arg/N-end rule pathway during Arabidopsis seedling establishment. DOI: 10.1038/s41598-018-33630-5 ; PMID: 30315202
- AP2/ERF Family Transcription Factors ORA59 and RAP2.3 Interact in the Nucleus and Function Together in Ethylene Responses. DOI: 10.3389/fpls.2018.01675 ; PMID: 30510560
- Transcriptional regulation of nitrogen-associated metabolism and growth. DOI: 10.1038/s41586-018-0656-3 ; PMID: 30356219
- Ethylene-mediated nitric oxide depletion pre-adapts plants to hypoxia stress. DOI: 10.1038/s41467-019-12045-4 ; PMID: 31488841
- A PXY-Mediated Transcriptional Network Integrates Signaling Mechanisms to Control Vascular Development in Arabidopsis. DOI: 10.1105/tpc.19.00562 ; PMID: 31806676
- AtMPK6-induced phosphorylation of AtERF72 enhances its DNA binding activity and interaction with TGA4/OBF4 in Arabidopsis. DOI: 10.1111/plb.13196 ; PMID: 33073469
- MPK3/MPK6-mediated phosphorylation of ERF72 positively regulates resistance to Botrytis cinerea through directly and indirectly activating the transcription of camalexin biosynthesis enzymes. DOI: 10.1093/jxb/erab415 ; PMID: 34499162
- Role of ethylene and proteolytic N-degron pathway in the regulation of Arabidopsis seed dormancy. DOI: 10.1111/jipb.13173 ; PMID: 34542217
- AtERF71/HRE2, an Arabidopsis AP2/ERF Transcription Factor Gene, Contains Both Positive and Negative Cis-Regulatory Elements in Its Promoter Region Involved in Hypoxia and Salt Stress Responses. DOI: 10.3390/ijms23105310 ; PMID: 35628120
- The AP2 domain of APETALA2 defines a large new family of DNA binding proteins in Arabidopsis. DOI: 10.1073/pnas.94.13.7076 ; PMID: 9192694
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Cloning by pathway activation in yeast: identification of an Arabidopsis thaliana F-box protein that can turn on glucose repression. DOI: 10.1023/a:1014440531842 ; PMID: 12008900
- Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades. DOI: 10.1111/j.1365-313X.2005.02530.x ; PMID: 16212609
- Genome-wide analysis of the ERF gene family in Arabidopsis and rice. DOI: 10.1104/pp.105.073783 ; PMID: 16407444
- Warm and cold parental reproductive environments affect seed properties, fitness, and cold responsiveness in Arabidopsis thaliana progenies. DOI: 10.1111/j.1365-3040.2006.01615.x ; PMID: 17238908
Gene Resources
- UniProt: A0A654F7W0
- EMBL: CACRSJ010000106, CACSHJ010000089
- AlphaFoldDB: A0A654F7W0
- EnsemblPlants: AT3G16770.1
- Gramene: AT3G16770.1
- KEGG: ath:AT3G16770
- Orthologous matrix: GDLVTHH
- ExpressionAtlas: AT3G16770
- InterPro: IPR001471, IPR016177, IPR036955
- PANTHER: PTHR31190, PTHR31190:SF142
- SUPFAM: SSF54171
- PROSITE: PS51032
- Gene3D: 3.30.730.10
- OrthoDB: A0A654F7W0
- SWISS-MODEL: A0A654F7W0
- Conserved Domain Database: cd00018
Homologs
- Brassica napus GSBRNA2T00137514001, GSBRNA2T00014423001, GSBRNA2T00057562001, GSBRNA2T00101905001, GSBRNA2T00153781001, GSBRNA2T00040116001
- Brassica oleracea XP_013604157.1, XP_013622327.1, XP_013584047.1, XP_013584046.1
- Brassica rapa XP_009135498.1, XP_009114507.1, XP_009146063.1, XP_009146062.1
- Raphanus raphanistrum RrC2267_p4
Sequences
cDNA Sequence
- >AT3G16770.1
TTTGTATTCAGAGAGCCAAAAAAAGGCTTACAATTTTGTCGTTATGTGGATTAGCCTTCAATTTGTTGTAACCGTCATGTATCAAGGAACATAAAACTATTAGAATTATTATTCTAATATAAAGTAATTCATTTCACTCACACTTTATTACCATAAAACATTTATTTTGCGCCTATAAAGGCATTTCAGCTCCACCGTAGGAAACTTTCTCTTGAAAGAAACCCACAGCAACAAACAGAGAAAATGTGTGGCGGTGCTATTATTTCCGATTATGCCCCTCTCGTCACCAAGGCCAAGGGCCGTAAACTCACGGCTGAGGAACTCTGGTCAGAGCTCGATGCTTCCGCCGCCGACGACTTCTGGGGTTTCTATTCCACCTCCAAACTCCATCCCACCAACCAAGTTAACGTGAAAGAGGAGGCAGTGAAGAAGGAGCAGGCAACAGAGCCGGGGAAACGGAGGAAGAGGAAGAATGTTTATAGAGGGATACGTAAGCGTCCATGGGGAAAATGGGCGGCTGAGATTCGAGATCCACGAAAAGGTGTTAGAGTTTGGCTTGGTACGTTCAACACGGCGGAGGAAGCTGCCATGGCTTATGATGTTGCGGCCAAGCAGATCCGTGGTGATAAAGCCAAGCTCAACTTCCCAGATCTGCACCATCCTCCTCCTCCTAATTATACTCCTCCGCCGTCATCGCCACGATCAACCGATCAGCCTCCGGCGAAGAAGGTCTGCGTTGTCTCTCAGAGTGAGAGCGAGTTAAGTCAGCCGAGTTTCCCGGTGGAGTGTATAGGATTTGGAAATGGGGACGAGTTTCAGAACCTGAGTTACGGATTTGAGCCGGATTATGATCTGAAACAGCAGATATCGAGCTTGGAATCGTTCCTTGAGCTGGACGGTAACACGGCGGAGCAACCGAGTCAGCTTGATGAGTCCGTTTCCGAGGTGGATATGTGGATGCTTGATGATGTCATTGCGTCGTATGAGTAAAAGAAAAAAAATAAGTTTAAAAAAAGTTAAATAAAGTCTGTAATATATATGTAACCGCCGTTACTTTTAAAAGGTTTTTACCGTCGCATTGGACTGCTGATGATGTCTGTTGTGTAATGTGTAGAATGTGACCAAATGGACGTTATATTACGGTTTGTGGTATTATTAGTTTCTTAGATGGAAAAACTTACATGTGTAAATAAGATTTGTAATGTAAGACGAAGTACTTATAACTTCTTAACTGTTTTGTGGTAGTCCTGATTCCTGAAACTAATGGGAATTAGTTTGTATATCAAACAGGGGTTCCTAACTTGTT
CDS Sequence
- >AT3G16770.1
ATGTGTGGCGGTGCTATTATTTCCGATTATGCCCCTCTCGTCACCAAGGCCAAGGGCCGTAAACTCACGGCTGAGGAACTCTGGTCAGAGCTCGATGCTTCCGCCGCCGACGACTTCTGGGGTTTCTATTCCACCTCCAAACTCCATCCCACCAACCAAGTTAACGTGAAAGAGGAGGCAGTGAAGAAGGAGCAGGCAACAGAGCCGGGGAAACGGAGGAAGAGGAAGAATGTTTATAGAGGGATACGTAAGCGTCCATGGGGAAAATGGGCGGCTGAGATTCGAGATCCACGAAAAGGTGTTAGAGTTTGGCTTGGTACGTTCAACACGGCGGAGGAAGCTGCCATGGCTTATGATGTTGCGGCCAAGCAGATCCGTGGTGATAAAGCCAAGCTCAACTTCCCAGATCTGCACCATCCTCCTCCTCCTAATTATACTCCTCCGCCGTCATCGCCACGATCAACCGATCAGCCTCCGGCGAAGAAGGTCTGCGTTGTCTCTCAGAGTGAGAGCGAGTTAAGTCAGCCGAGTTTCCCGGTGGAGTGTATAGGATTTGGAAATGGGGACGAGTTTCAGAACCTGAGTTACGGATTTGAGCCGGATTATGATCTGAAACAGCAGATATCGAGCTTGGAATCGTTCCTTGAGCTGGACGGTAACACGGCGGAGCAACCGAGTCAGCTTGATGAGTCCGTTTCCGAGGTGGATATGTGGATGCTTGATGATGTCATTGCGTCGTATGAGTAA
Protein Sequence
- >AT3G16770.1
MCGGAIISDYAPLVTKAKGRKLTAEELWSELDASAADDFWGFYSTSKLHPTNQVNVKEEAVKKEQATEPGKRRKRKNVYRGIRKRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAMAYDVAAKQIRGDKAKLNFPDLHHPPPPNYTPPPSSPRSTDQPPAKKVCVVSQSESELSQPSFPVECIGFGNGDEFQNLSYGFEPDYDLKQQISSLESFLELDGNTAEQPSQLDESVSEVDMWMLDDVIASYE