Information report for AT3G15540
Gene Details
|
|
Functional Descriptions
- GO:0005515 — enables — protein binding
- GO:0080086 — acts upstream of or within — stamen filament development
- GO:0009733 — acts upstream of or within — response to auxin
- GO:0003700 — enables — DNA-binding transcription factor activity
- GO:0009630 — acts upstream of or within — gravitropism
- GO:0006355 — involved in — regulation of DNA-templated transcription
- GO:0009638 — acts upstream of or within — phototropism
- GO:0005634 — located in — nucleus
- GO:0042802 — enables — identical protein binding
Functional Keywords
Literature and News
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Genetics of Aux/IAA and ARF action in plant growth and development. DOI: NA ; PMID: 12036262
- Regulation of genes associated with auxin, ethylene and ABA pathways by 2,4-dichlorophenoxyacetic acid in Arabidopsis. DOI: 10.1007/s10142-005-0012-1 ; PMID: 16317577
- Arabidopsis Aux/IAA genes are involved in brassinosteroid-mediated growth responses in a manner dependent on organ type. DOI: 10.1111/j.1365-313X.2005.02582.x ; PMID: 16367964
- The Arabidopsis Aux/IAA protein family has diversified in degradation and auxin responsiveness. DOI: 10.1105/tpc.105.039172 ; PMID: 16489122
- Fluorescence cross-correlation analyses of the molecular interaction between an Aux/IAA protein, MSG2/IAA19, and protein-protein interaction domains of auxin response factors of arabidopsis expressed in HeLa cells. DOI: 10.1093/pcp/pcj080 ; PMID: 16854942
- Specificity and similarity of functions of the Aux/IAA genes in auxin signaling of Arabidopsis revealed by promoter-exchange experiments among MSG2/IAA19, AXR2/IAA7, and SLR/IAA14. DOI: 10.1104/pp.107.096628 ; PMID: 17369427
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- The DOF transcription factor Dof5.1 influences leaf axial patterning by promoting Revoluta transcription in Arabidopsis. DOI: 10.1111/j.1365-313X.2010.04346.x ; PMID: 20807212
- Differentiation of Arabidopsis guard cells: analysis of the networks incorporating the basic helix-loop-helix transcription factor, FAMA. DOI: 10.1104/pp.110.167718 ; PMID: 21245191
- Identical amino acid substitutions in the repression domain of auxin/indole-3-acetic acid proteins have contrasting effects on auxin signaling. DOI: 10.1104/pp.110.171322 ; PMID: 21252300
- Arabidopsis thaliana TERMINAL FLOWER2 is involved in light-controlled signalling during seedling photomorphogenesis. DOI: 10.1111/j.1365-3040.2011.02468.x ; PMID: 22145973
- The heterozygous abp1/ABP1 insertional mutant has defects in functions requiring polar auxin transport and in regulation of early auxin-regulated genes. DOI: 10.1111/j.1365-313X.2010.04420.x ; PMID: 21223392
- A survey of dominant mutations in Arabidopsis thaliana. DOI: 10.1016/j.tplants.2012.08.006 ; PMID: 22995285
- and PIF4-mediated double coincidence mechanism is implicated in the thermosensitive photoperiodic control of plant architectures in Arabidopsis thaliana. DOI: 10.1093/pcp/pcs141 ; PMID: 23037004
- and PIF4-controlled plant growth: a coincidence mechanism directly integrates a hormone signaling network into the photoperiodic control of plant architectures in Arabidopsis thaliana. DOI: 10.1093/pcp/pcs137 ; PMID: 23037003
- Brassinosteroids regulate the differential growth of Arabidopsis hypocotyls through auxin signaling components IAA19 and ARF7. DOI: 10.1093/mp/sss123 ; PMID: 23125315
- PIF4 and PIF5 transcription factors link blue light and auxin to regulate the phototropic response in Arabidopsis. DOI: 10.1105/tpc.113.112417 ; PMID: 23757399
- ERECTA family genes regulate auxin transport in the shoot apical meristem and forming leaf primordia. DOI: 10.1104/pp.113.218198 ; PMID: 23821653
- Plant Stress Tolerance Requires Auxin-Sensitive Aux/IAA Transcriptional Repressors. DOI: 10.1016/j.cub.2016.12.016 ; PMID: 28111153
- PICKLE chromatin-remodeling factor controls thermosensory hypocotyl growth of Arabidopsis. DOI: 10.1111/pce.13049 ; PMID: 28771755
- Suppression of Arabidopsis flowering by near-null magnetic field is mediated by auxin. DOI: 10.1002/bem.22086 ; PMID: 28940601
- Linking PHYTOCHROME-INTERACTING FACTOR to Histone Modification in Plant Shade Avoidance. DOI: 10.1104/pp.17.01189 ; PMID: 29187567
- Rewiring of auxin signaling under persistent shade. DOI: 10.1073/pnas.1721110115 ; PMID: 29724856
- Photoexcited CRYPTOCHROME1 Interacts with Dephosphorylated BES1 to Regulate Brassinosteroid Signaling and Photomorphogenesis in Arabidopsis. DOI: 10.1105/tpc.17.00994 ; PMID: 30131420
- Auxin-sensitive Aux/IAA proteins mediate drought tolerance in Arabidopsis by regulating glucosinolate levels. DOI: 10.1038/s41467-019-12002-1 ; PMID: 31492889
- Light controls stamen elongation via cryptochromes, phytochromes and COP1 through HY5 and HYH. DOI: 10.1111/tpj.14736 ; PMID: 32142184
- HBI1 acts downstream of ERECTA and SWR1 in regulating inflorescence architecture through the activation of the brassinosteroid and auxin signaling pathways. DOI: 10.1111/nph.16840 ; PMID: 32746499
- Class I TCP proteins TCP14 and TCP15 are required for elongation and gene expression responses to auxin. DOI: 10.1007/s11103-020-01075-y ; PMID: 32935297
- Arabidopsis NF-YCs play dual roles in repressing brassinosteroid biosynthesis and signaling during light-regulated hypocotyl elongation. DOI: 10.1093/plcell/koab112 ; PMID: 33871651
- Gene co-expression network analysis identifies BEH3 as a stabilizer of secondary vascular development in Arabidopsis. DOI: 10.1093/plcell/koab151 ; PMID: 34059919
- MEDIATOR SUBUNIT17 integrates jasmonate and auxin signaling pathways to regulate thermomorphogenesis. DOI: 10.1093/plphys/kiac220 ; PMID: 35567489
- INOSITOL (1,3,4) TRIPHOSPHATE 5/6 KINASE1-dependent inositol polyphosphates regulate auxin responses in Arabidopsis. DOI: 10.1093/plphys/kiac425 ; PMID: 36124979
- CPR5-mediated nucleo-cytoplasmic localization of IAA12 and IAA19 controls lateral root development during abiotic stress. DOI: 10.1073/pnas.2209781120 ; PMID: 36623191
- Conserved and plant-specific histone acetyltransferase complexes cooperate to regulate gene transcription and plant development. DOI: 10.1038/s41477-023-01359-3 ; PMID: 36879016
- PIFs interact with SWI2/SNF2-related 1 complex subunit 6 to regulate H2A.Z deposition and photomorphogenesis in Arabidopsis. DOI: 10.1016/j.jgg.2023.04.008 ; PMID: 37120038
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. DOI: 10.1093/molbev/msj051 ; PMID: 16280546
Gene Resources
- UniProt: Q2VWA2
- EMBL: AY669798, BT024586
- AlphaFoldDB: Q2VWA2
- EnsemblPlants: AT3G15540.1
- Gramene: AT3G15540.1
- KEGG: ath:AT3G15540
- Orthologous matrix: KDAENCE
- ExpressionAtlas: AT3G15540
- InterPro: IPR003311, IPR033389, IPR053793
- PANTHER: PTHR31734, PTHR31734:SF121
- SUPFAM: SSF54277
- PROSITE: PS51745
- Gene3D: 3.10.20.90
- SWISS-MODEL: Q2VWA2
Homologs
- Actinidia chinensis CEY00_Acc13467, CEY00_Acc04212
- Brassica napus BnaA03G0375100ZS, BnaA05G0331100ZS
- Brassica oleracea Bo3g081600
- Brassica rapa Bra001900, Bra033886
- Glycine max Glyma.03G158700, Glyma.19G161100
- Gossypium hirsutum Gohir.D11G132700
- Juglans regia Jr01_31360
- Malus domestica MdIAA3
- Nicotiana attenuata A4A49_02602
- Oryza sativa OsIAA11
- Rosa chinensis RchiOBHm_Chr4g0389621
- Triticum aestivum TaIAA17-3A, TaIAA21-A, TaIAA17-3B
Sequences
cDNA Sequence
- >AT3G15540.1
CGACGCGGTGCCATTACTACAATAAGAGAAGTGTAGGAGAAGAAAGTTCTCATTTCATAATTGTATCAAATTGTGAGAGGAAAAAAAGAAGTTCAAGAAATGGAGAAGGAAGGACTCGGGCTTGAGATAACGGAGCTGAGATTGGGGCTTCCGGGGAGAGATGTGGCAGAGAAGATGATGAAGAAGAGAGCTTTCACGGAGATGAATATGACGTCGTCGGGTAGTAATAGTGATCAATGTGAAAGCGGCGTCGTTTCATCTGGTGGTGACGCTGAGAAGGTTAATGATTCGCCGGCGGCGAAAAGCCAGGTGGTGGGGTGGCCACCGGTTTGTTCTTACCGGAAGAAAAACAGCTGTAAGGAAGCTTCGACCACGAAAGTGGGGTTAGGGTATGTGAAAGTGAGCATGGATGGTGTGCCTTATTTGAGGAAGATGGATCTTGGTTCGAGCCAAGGCTATGATGATCTAGCCTTTGCTCTTGATAAGCTCTTCGGTTTCCGTGGCATCGGTGTGGCCTTGAAAGATGGTGACAACTGCGAATACGTTACCATATACGAAGACAAAGATGGAGACTGGATGCTCGCCGGTGATGTACCTTGGGGGATGTTTCTAGAGTCATGCAAGAGGTTGAGAATAATGAAAAGATCGGATGCTACCGGGTTTGGGCTGCAGCCTAGAGGAGTAGACGAGTGATGATGACTTGAACAAGAAGCAAGGAGCTGGTTCATTAATTTAATCTTAAACTTGATCATCAAGATCCTTTAGAACATTTTTCCTATTCATGTTATATAAATATATATGTTATAGTATATTATTTTGCAACAAAATTTCATGTTATGGTTTTGCATAATTATCTTCAGAAAGACAGCTATATATATATACACTACTTGTTTCTTGAGTGTTGAGTTAAAACATTAATCTGTTTCAAAATTTATTGTTATTTCGGATCTATATATGTGTGTAGAAACATATGTAATAAGTATCCATTATTTCATCTTTTTAAAAAATAA
CDS Sequence
- >AT3G15540.1
ATGGAGAAGGAAGGACTCGGGCTTGAGATAACGGAGCTGAGATTGGGGCTTCCGGGGAGAGATGTGGCAGAGAAGATGATGAAGAAGAGAGCTTTCACGGAGATGAATATGACGTCGTCGGGTAGTAATAGTGATCAATGTGAAAGCGGCGTCGTTTCATCTGGTGGTGACGCTGAGAAGGTTAATGATTCGCCGGCGGCGAAAAGCCAGGTGGTGGGGTGGCCACCGGTTTGTTCTTACCGGAAGAAAAACAGCTGTAAGGAAGCTTCGACCACGAAAGTGGGGTTAGGGTATGTGAAAGTGAGCATGGATGGTGTGCCTTATTTGAGGAAGATGGATCTTGGTTCGAGCCAAGGCTATGATGATCTAGCCTTTGCTCTTGATAAGCTCTTCGGTTTCCGTGGCATCGGTGTGGCCTTGAAAGATGGTGACAACTGCGAATACGTTACCATATACGAAGACAAAGATGGAGACTGGATGCTCGCCGGTGATGTACCTTGGGGGATGTTTCTAGAGTCATGCAAGAGGTTGAGAATAATGAAAAGATCGGATGCTACCGGGTTTGGGCTGCAGCCTAGAGGAGTAGACGAGTGA
Protein Sequence
- >AT3G15540.1
MEKEGLGLEITELRLGLPGRDVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGDAEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSSQGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRLRIMKRSDATGFGLQPRGVDE