Information report for AT3G06120
Gene Details
|
|
Functional Descriptions
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
- PO:0000351 — guard mother cell — célula madre de la célula guardiana (Spanish, exact), 孔辺母細胞 (Japanese, exact)
- PO:0004011 — initial cell — célula inicial (Spanish, exact), initial (exact), meristemoid (exact), 始原細胞 (Japanese, exact), stem cell (related)
- GO:0005634 — located in — nucleus
- GO:0003700 — enables — DNA-binding transcription factor activity
- GO:0045893 — involved in — positive regulation of DNA-templated transcription
- GO:0010052 — involved in — guard cell differentiation
- GO:0090627 — acts upstream of or within — plant epidermal cell differentiation
- GO:0005634 — is active in — nucleus
- GO:0010374 — involved in — stomatal complex development
- GO:0046983 — enables — protein dimerization activity
- GO:0010374 — acts upstream of or within — stomatal complex development
- GO:0000976 — enables — transcription cis-regulatory region binding
- mute — Complete absence of stomata. Plants are small, pale and sterile. Meristemoids undergo 3-6 rounds (vs. 1-3 rounds in wild type) of asymmetric division. These divisions create a rosette pattern in the mute epidermis with an arrested, small triangular meristemoid at the center.
- mute — Mutants express high levels of stomatal lineage cell markers TMM and ERL1.
Functional Keywords
Literature and News
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity. DOI: 10.1093/molbev/msg088 ; PMID: 12679534
- The Arabidopsis basic/helix-loop-helix transcription factor family. DOI: 10.1105/tpc.013839 ; PMID: 12897250
- Cell fate transitions during stomatal development. DOI: 10.1002/bies.200800231 ; PMID: 19565615
- Cryptochromes, phytochromes, and COP1 regulate light-controlled stomatal development in Arabidopsis. DOI: 10.1105/tpc.109.069765 ; PMID: 19794114
- Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature. DOI: 10.1016/j.diff.2010.02.003 ; PMID: 20219281
- Induced accumulation of cuticular waxes enhances drought tolerance in Arabidopsis by changes in development of stomata. DOI: 10.1016/j.plaphy.2011.09.006 ; PMID: 22078383
- Timely expression of the Arabidopsis stoma-fate master regulator MUTE is required for specification of other epidermal cell types. DOI: 10.1111/tpj.12244 ; PMID: 23662679
- EPIDERMAL PATTERNING FACTOR LIKE5 peptide represses stomatal development by inhibiting meristemoid maintenance in Arabidopsis thaliana. DOI: 10.1271/bbb.130145 ; PMID: 23748792
- LLM-Domain B-GATA Transcription Factors Promote Stomatal Development Downstream of Light Signaling Pathways in Arabidopsis thaliana Hypocotyls. DOI: 10.1105/tpc.15.00783 ; PMID: 26917680
- Nitric oxide is involved in stomatal development by modulating the expression of stomatal regulator genes in Arabidopsis. DOI: 10.1016/j.plantsci.2016.08.005 ; PMID: 27717464
- Auxin represses stomatal development in dark-grown seedlings via Aux/IAA proteins. DOI: 10.1242/dev.109181 ; PMID: 25063454
- Light Inhibits COP1-Mediated Degradation of ICE Transcription Factors to Induce Stomatal Development in Arabidopsis. DOI: 10.1105/tpc.17.00371 ; PMID: 29070509
- MUTE Directly Orchestrates Cell-State Switch and the Single Symmetric Division to Create Stomata. DOI: 10.1016/j.devcel.2018.04.010 ; PMID: 29738710
- Transcriptional regulation of nitrogen-associated metabolism and growth. DOI: 10.1038/s41586-018-0656-3 ; PMID: 30356219
- Inhibition of Arabidopsis stomatal development by plastoquinone oxidation. DOI: 10.1016/j.cub.2021.10.018 ; PMID: 34727522
- FOUR LIPS plays a role in meristemoid-to-GMC fate transition during stomatal development in Arabidopsis. DOI: 10.1111/tpj.16146 ; PMID: 36786686
- Targeted expression of bgl23-D, a dominant-negative allele of ATCSLD5, affects cytokinesis of guard mother cells and exine formation of pollen in Arabidopsis thaliana. DOI: 10.1007/s00425-023-04097-0 ; PMID: 36811672
- Cell type-specific proteomics uncovers a RAF15-SnRK2.6/OST1 kinase cascade in guard cells. DOI: 10.1111/jipb.13536 ; PMID: 37226855
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity. DOI: 10.1093/molbev/msg088 ; PMID: 12679534
- Influence of environmental factors on stomatal development. DOI: 10.1111/j.1469-8137.2007.02351.x ; PMID: 18266617
- SCREAM/ICE1 and SCREAM2 specify three cell-state transitional steps leading to arabidopsis stomatal differentiation. DOI: 10.1105/tpc.108.060848 ; PMID: 18641265
Gene Resources
- UniProt: A0A178VCY0
- EMBL: CACRSJ010000106, CACSHJ010000089, LUHQ01000003
- AlphaFoldDB: A0A178VCY0
- EnsemblPlants: AT3G06120.1
- Gramene: AT3G06120.1
- KEGG: ath:AT3G06120
- Orthologous matrix: VQQSFCS
- ExpressionAtlas: AT3G06120
- InterPro: IPR011598, IPR036638, IPR044283
- PANTHER: PTHR46684, PTHR46684:SF1
- SUPFAM: SSF47459
- PROSITE: PS50888
- Gene3D: 4.10.280.10
- OrthoDB: A0A178VCY0
- SWISS-MODEL: A0A178VCY0
- Conserved Domain Database: cd11448
Homologs
- Brassica napus GSBRNA2T00006019001, GSBRNA2T00125324001, GSBRNA2T00023472001, GSBRNA2T00027106001, GSBRNA2T00120047001
- Brassica oleracea XP_013588252.1, XP_013627088.1, XP_013585010.1
- Brassica rapa XP_009124939.1, XP_009134872.1, XP_009129643.1
- Raphanus raphanistrum RrC3740_p3, RrC13867_p1
Sequences
cDNA Sequence
- >AT3G06120.1
TGTCGAACAAAGTGAAAACATAAGATCATCTTCTTCGTTGATAGATCAATATAGGAACTCCAGAAGAGAATCTTGATCAATTAAGTATCATGTCTCACATCGCTGTTGAAAGGAATCGAAGAAGGCAAATGAACGAGCATCTTAAATCCCTTCGTTCTTTGACTCCTTGTTTCTACATCAAAAGGGGAGATCAAGCTTCGATCATCGGAGGAGTGATAGAGTTCATCAAAGAGTTGCAGCAATTGGTTCAAGTTCTTGAGTCCAAGAAACGTCGAAAGACCCTAAACCGACCATCTTTCCCTTATGATCACCAGACAATCGAGCCATCCAGTTTAGGAGCCGCCACTACCCGAGTACCGTTTAGTCGAATCGAAAATGTGATGACCACAAGTACTTTCAAGGAAGTAGGAGCATGCTGTAACTCCCCTCATGCTAACGTAGAAGCAAAGATTTCAGGTTCTAATGTTGTATTGAGAGTTGTCTCTAGGCGAATCGTGGGGCAGCTCGTAAAGATCATCTCTGTCTTAGAGAAGCTATCTTTTCAAGTTCTTCACCTCAATATTAGTAGCATGGAGGAGACTGTCTTATACTTTTTCGTTGTTAAGATAGGATTGGAGTGTCACTTAAGCTTGGAGGAGCTAACTCTTGAAGTTCAGAAAAGCTTTGTGTCTGATGAAGTGATCGTCTCTACCAATTAAAAACAAAATTCTACATGTACTAGAGCGTGTATCGTTTTTTGGGATTAATAATCATATAATCGTTACATGAGCCTTGATACTTTGCTAGAAATAAGCTCCTCTAAACAAAACCTTCTTTTTAAAAAAACACACTTATGTTTTACTTAGTTTGTTGTTGTATCCGAAGTTGATCAACGTTGTAATTTCCCACAATAAATCATGACATTTTATATGCTCTAATTAACTAGTATAATATAGTTCTGA
CDS Sequence
- >AT3G06120.1
ATGTCTCACATCGCTGTTGAAAGGAATCGAAGAAGGCAAATGAACGAGCATCTTAAATCCCTTCGTTCTTTGACTCCTTGTTTCTACATCAAAAGGGGAGATCAAGCTTCGATCATCGGAGGAGTGATAGAGTTCATCAAAGAGTTGCAGCAATTGGTTCAAGTTCTTGAGTCCAAGAAACGTCGAAAGACCCTAAACCGACCATCTTTCCCTTATGATCACCAGACAATCGAGCCATCCAGTTTAGGAGCCGCCACTACCCGAGTACCGTTTAGTCGAATCGAAAATGTGATGACCACAAGTACTTTCAAGGAAGTAGGAGCATGCTGTAACTCCCCTCATGCTAACGTAGAAGCAAAGATTTCAGGTTCTAATGTTGTATTGAGAGTTGTCTCTAGGCGAATCGTGGGGCAGCTCGTAAAGATCATCTCTGTCTTAGAGAAGCTATCTTTTCAAGTTCTTCACCTCAATATTAGTAGCATGGAGGAGACTGTCTTATACTTTTTCGTTGTTAAGATAGGATTGGAGTGTCACTTAAGCTTGGAGGAGCTAACTCTTGAAGTTCAGAAAAGCTTTGTGTCTGATGAAGTGATCGTCTCTACCAATTAA
Protein Sequence
- >AT3G06120.1
MSHIAVERNRRRQMNEHLKSLRSLTPCFYIKRGDQASIIGGVIEFIKELQQLVQVLESKKRRKTLNRPSFPYDHQTIEPSSLGAATTRVPFSRIENVMTTSTFKEVGACCNSPHANVEAKISGSNVVLRVVSRRIVGQLVKIISVLEKLSFQVLHLNISSMEETVLYFFVVKIGLECHLSLEELTLEVQKSFVSDEVIVSTN