Information report for AT3G05020
Gene Details
|
|
Functional Descriptions
- PO:0000282 — trichome — tricoma (Spanish, exact), 毛茸、糸状体、毛 (Japanese, exact), seta (related), setae (related), capilli (narrow), capillus (narrow), cilia (narrow), cilium (narrow), glochid (narrow), glochidia (narrow), glochidium (narrow), hair (narrow), lepides (narrow), lepis (narrow), non-secretory trichome (narrow), scale (narrow), squama (narrow), squamae (narrow), squamella (narrow), squamellae (narrow), squamule (narrow), barb trichome (broad), bristle (broad)
Functional Keywords
Literature and News
- Deficiency in fatty acid synthase leads to premature cell death and dramatic alterations in plant morphology. DOI: 10.1105/tpc.12.3.405 ; PMID: 10715326
- Analysis of two linked genes coding for the acyl carrier protein (ACP) from Arabidopsis thaliana (columbia). DOI: 10.1007/BF00023997 ; PMID: 1893112
- Differential regulation of mRNA levels of acyl carrier protein isoforms in Arabidopsis. DOI: 7044 ; PMID: 11788768
- Expression of constitutive and tissue-specific acyl carrier protein isoforms in Arabidopsis. DOI: 10.1104/pp.98.1.206 ; PMID: 16668615
- Characterization of substrate specificity of plant FatA and FatB acyl-ACP thioesterases. DOI: 10.1016/S0003-9861(02)00017-6 ; PMID: 12061798
- What limits production of unusual monoenoic fatty acids in transgenic plants? DOI: 10.1007/s00425-002-0751-3 ; PMID: 12172841
- Enhanced resistance to Cucumber mosaic virus in the Arabidopsis thaliana ssi2 mutant is mediated via an SA-independent mechanism. DOI: 10.1094/MPMI.2004.17.6.623 ; PMID: 15195945
- Changes in the endoplasmic reticulum lipid properties in response to low temperature in Brassica napus. DOI: 10.1016/j.plaphy.2004.10.001 ; PMID: 15596101
- Arabidopsis ssi2-conferred susceptibility to Botrytis cinerea is dependent on EDS5 and PAD4. DOI: 10.1094/MPMI-18-0363 ; PMID: 15828688
- Pantothenate biosynthesis in higher plants. DOI: 10.1042/BST0330743 ; PMID: 16042590
- Modulating seed beta-ketoacyl-acyl carrier protein synthase II level converts the composition of a temperate seed oil to that of a palm-like tropical oil. DOI: 10.1073/pnas.0611141104 ; PMID: 17360594
- Mitochondrial acyl carrier proteins in Arabidopsis thaliana are predominantly soluble matrix proteins and none can be confirmed as subunits of respiratory Complex I. DOI: 10.1007/s11103-007-9156-9 ; PMID: 17406791
- Production of short-chain-length/medium-chain-length polyhydroxyalkanoate (PHA) copolymer in the plastid of Arabidopsis thaliana using an engineered 3-ketoacyl-acyl carrier protein synthase III. DOI: 10.1021/bm8013878 ; PMID: 19265441
- Acyl-lipid metabolism. DOI: 10.1199/tab.0161 ; PMID: 23505340
- Deficient plastidic fatty acid synthesis triggers cell death by modulating mitochondrial reactive oxygen species. DOI: 10.1038/cr.2015.46 ; PMID: 25906995
- Genes of ACYL CARRIER PROTEIN Family Show Different Expression Profiles and Overexpression of ACYL CARRIER PROTEIN 5 Modulates Fatty Acid Composition and Enhances Salt Stress Tolerance in Arabidopsis. DOI: 10.3389/fpls.2017.00987 ; PMID: 28642782
- Mitochondrial Fatty Acid Synthase Utilizes Multiple Acyl Carrier Protein Isoforms. DOI: 10.1104/pp.19.01468 ; PMID: 32094306
- Dual-Localized Enzymatic Components Constitute the Fatty Acid Synthase Systems in Mitochondria and Plastids. DOI: 10.1104/pp.19.01564 ; PMID: 32245791
- Cell-specific protein profiling in Arabidopsis thaliana trichomes: identification of trichome-located proteins involved in sulfur metabolism and detoxification. DOI: 10.1016/j.phytochem.2004.03.026 ; PMID: 15276459
- Sorting signals, N-terminal modifications and abundance of the chloroplast proteome. DOI: 10.1371/journal.pone.0001994 ; PMID: 18431481
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Gene Resources
- UniProt: Q0WT41
- EMBL: AK227721
- AlphaFoldDB: Q0WT41
- EnsemblPlants: AT3G05020.1
- Gramene: AT3G05020.1
- KEGG: ath:AT3G05020
- Orthologous matrix: EFNIQMA
- ExpressionAtlas: AT3G05020
Homologs
- Glycine max GmACP
- Saccharum spontaneum Sspon.06G0025190-2C
Sequences
cDNA Sequence
- >AT3G05020.1
ACGCTCTTTGTACACTCCGCCCTCTCTCCCCATCTCTTTCGACAGATCTCTTCTCTCTCTCGTGTTTCACGAAACAATGGCGACTCAATTCAGCGCTTCTGTCTCATTGCAAACTTCTTGTCTGGCAACAACAAGGATTAGTTTCCAAAAGCCAGCTTTGATTTCCAACCATGGAAAGACTAATCTATCCTTCAACCTCCGCCGTTCAATCCCATCTCGCCGCCTCTCTGTTTCTTGCGCGGCAAAACAAGAGACGATAGAGAAAGTGTCTGCTATAGTTAAGAAGCAACTATCACTTACACCGGATAAAAAAGTCGTTGCAGAAACCAAATTTGCTGACCTTGGAGCAGATTCTCTCGACACGGTTGAGATAGTAATGGGTTTAGAGGAAGAGTTTAACATCCAAATGGCCGAAGAGAAAGCACAGAAGATTGCCACAGTTGAGCAAGCTGCTGAACTCATTGAAGAGCTCATCAACGAGAAGAAGTAATTTTAGTTTTCTTTTATAAAATGCCCTTAAATAAACTAAAAAAGAAAACGACAAAAAAAAACAGGGCGTTGAGTTTGTTTTCATTATGTTTGATTTCTCTGTCATTTTCTTTAATGTGTCTAGCGAGTCTGCCTTTGTCCCAATGGTTTAGTATCTGCATGTATCCACGGATCTCTATTTGTCGACGAATGTTATTTACAATAAGTGTTTCTTATTTTCTTTCCAAGATCG
CDS Sequence
- >AT3G05020.1
ATGGCGACTCAATTCAGCGCTTCTGTCTCATTGCAAACTTCTTGTCTGGCAACAACAAGGATTAGTTTCCAAAAGCCAGCTTTGATTTCCAACCATGGAAAGACTAATCTATCCTTCAACCTCCGCCGTTCAATCCCATCTCGCCGCCTCTCTGTTTCTTGCGCGGCAAAACAAGAGACGATAGAGAAAGTGTCTGCTATAGTTAAGAAGCAACTATCACTTACACCGGATAAAAAAGTCGTTGCAGAAACCAAATTTGCTGACCTTGGAGCAGATTCTCTCGACACGGTTGAGATAGTAATGGGTTTAGAGGAAGAGTTTAACATCCAAATGGCCGAAGAGAAAGCACAGAAGATTGCCACAGTTGAGCAAGCTGCTGAACTCATTGAAGAGCTCATCAACGAGAAGAAGTAA
Protein Sequence
- >AT3G05020.1
MATQFSASVSLQTSCLATTRISFQKPALISNHGKTNLSFNLRRSIPSRRLSVSCAAKQETIEKVSAIVKKQLSLTPDKKVVAETKFADLGADSLDTVEIVMGLEEEFNIQMAEEKAQKIATVEQAAELIEELINEKK