Information report for AT3G04720
Gene Details
|
|
Functional Descriptions
- GO:0004540 — enables — RNA nuclease activity
- GO:0009723 — acts upstream of or within — response to ethylene
- GO:0009615 — acts upstream of or within — response to virus
- GO:0008061 — enables — chitin binding
- GO:0042742 — involved in — defense response to bacterium
- GO:0009627 — acts upstream of or within — systemic acquired resistance
- GO:0099503 — located in — secretory vesicle
- GO:0080027 — acts upstream of or within — response to herbivore
- GO:0005576 — located in — extracellular region
Functional Keywords
Literature and News
- Rhizobacteria-mediated induced systemic resistance (ISR) in Arabidopsis is not associated with a direct effect on expression of known defense-related genes but stimulates the expression of the jasmonate-inducible gene Atvsp upon challenge. DOI: 10.1023/a:1006319216982 ; PMID: 10608663
- Separate jasmonate-dependent and salicylate-dependent defense-response pathways in Arabidopsis are essential for resistance to distinct microbial pathogens. DOI: 10.1073/pnas.95.25.15107 ; PMID: 9844023
- Tomato transcription factors pti4, pti5, and pti6 activate defense responses when expressed in Arabidopsis. DOI: 10.1105/tpc.000794 ; PMID: 11971137
- A role for the GCC-box in jasmonate-mediated activation of the PDF1.2 gene of Arabidopsis. DOI: 10.1104/pp.102.017814 ; PMID: 12805630
- Early responses in the Arabidopsis-Verticillium longisporum pathosystem are and ET-associated signals via cytosolic NPR1 and RFO1. DOI: 10.1094/MPMI-19-0958 ; PMID: 16941900
- Silverleaf whitefly induces salicylic acid defenses and suppresses effectual jasmonic acid defenses. DOI: 10.1104/pp.106.090035 ; PMID: 17189328
- Pathogen-associated molecular pattern recognition rather than development of tissue necrosis contributes to bacterial induction of systemic acquired resistance in Arabidopsis. DOI: 10.1111/j.1365-313X.2007.03067.x ; PMID: 17419843
- The plant growth-promoting fungus Penicillium simplicissimum GP17-2 induces resistance in Arabidopsis thaliana by activation of multiple defense signals. DOI: 10.1093/pcp/pcm144 ; PMID: 17956859
- Molecular and functional profiling of Arabidopsis pathogenesis-related genes: insights into their roles in salt response of seed germination. DOI: 10.1093/pcp/pcn011 ; PMID: 18203731
- The AP2/ERF domain transcription factor ORA59 integrates jasmonic acid and ethylene signals in plant defense. DOI: 10.1104/pp.108.117523 ; PMID: 18467450
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Heterotrimeric G proteins-mediated resistance to necrotrophic pathogens includes and abscisic acid-mediated defense signaling. DOI: 10.1111/j.1365-313X.2008.03755.x ; PMID: 19054360
- Ecological modulation of plant defense via phytochrome control of jasmonate sensitivity. DOI: 10.1073/pnas.0900701106 ; PMID: 19251652
- Proteomics of the response of Arabidopsis thaliana to infection with Alternaria brassicicola. DOI: 10.1016/j.jprot.2009.10.005 ; PMID: 19857612
- Expression of BvGLP-1 encoding a germin-like protein from sugar beet in Arabidopsis thaliana leads to resistance against phytopathogenic fungi. DOI: 10.1094/MPMI-23-4-0446 ; PMID: 20192832
- The RNA binding protein Tudor-SN is essential for stress tolerance and stabilizes levels of stress-responsive mRNAs encoding secreted proteins in Arabidopsis. DOI: 10.1105/tpc.109.070680 ; PMID: 20484005
- Priming for JA-dependent defenses using hexanoic acid is an effective mechanism to protect Arabidopsis against B. cinerea. DOI: 10.1016/j.jplph.2010.07.028 ; PMID: 20950893
- Expression of Arabidopsis pathogenesis-related genes during nematode infection. DOI: 10.1111/j.1364-3703.2010.00675.x ; PMID: 21453430
- The homologous homeodomain-leucine zipper transcription factors HaHB1 and AtHB13 confer tolerance to drought and salinity stresses via the induction of proteins that stabilize membranes. DOI: 10.1111/j.1467-7652.2012.00701.x ; PMID: 22564282
- Uncovering the defence responses of Eucalyptus to pests and pathogens in the genomics age. DOI: 10.1093/treephys/tpu075 ; PMID: 25261123
- Isolation of a WRKY30 gene from Muscadinia rotundifolia (Michx) and validation of its function under biotic and abiotic stresses. DOI: 10.1007/s00709-015-0769-6 ; PMID: 25643917
- ETHYLENE RESPONSE FACTOR 96 positively regulates Arabidopsis resistance to and ethylene-responsive defence genes. DOI: 10.1111/pce.12583 ; PMID: 26038230
- SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. DOI: 10.1104/pp.15.01112 ; PMID: 26304848
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Genome-Wide Screening for Lectin Motifs in Arabidopsis thaliana. DOI: 10.3835/plantgenome2017.02.0010 ; PMID: 28724081
- MiR858-Mediated Regulation of Flavonoid-Specific MYB Transcription Factor Genes Controls Resistance to Pathogen Infection in Arabidopsis. DOI: 10.1093/pcp/pcx175 ; PMID: 29149328
- Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. DOI: 10.1186/s12870-018-1255-z ; PMID: 29490615
- Cold stress activates disease resistance in Arabidopsis thaliana through a salicylic acid dependent pathway. DOI: 10.1111/pce.13579 ; PMID: 31087367
- Inactivation of UDP-Glucose Sterol Glucosyltransferases Enhances Arabidopsis Resistance to Botrytis cinerea. DOI: 10.3389/fpls.2019.01162 ; PMID: 31611892
- MYC2-Activated TRICHOME BIREFRINGENCE-LIKE37 Acetylates Cell Walls and Enhances Herbivore Resistance. DOI: 10.1104/pp.20.00683 ; PMID: 32732351
- An ER-Golgi Tethering Factor SLOH4/MIP3 Is Involved in Long-Term Heat Tolerance of Arabidopsis. DOI: 10.1093/pcp/pcaa157 ; PMID: 33367686
- Proteomic Analysis of Proteins Related to Defense Responses in Arabidopsis Plants Transformed with the rolB Oncogene. DOI: 10.3390/ijms24031880 ; PMID: 36768198
- Comparative proteomic analysis of NaCl stress-responsive proteins in Arabidopsis roots. DOI: 10.1093/jxb/erm207 ; PMID: 17916636
- The AP2/ERF domain transcription factor ORA59 integrates jasmonic acid and ethylene signals in plant defense. DOI: 10.1104/pp.108.117523 ; PMID: 18467450
- RD19, an Arabidopsis cysteine protease required for RRS1-R-mediated resistance, is relocalized to the nucleus by the Ralstonia solanacearum PopP2 effector. DOI: 10.1105/tpc.108.058685 ; PMID: 18708476
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Gene Resources
- UniProt: A0A178VMU7
- EMBL: CACRSJ010000106, CACSHJ010000089, LR881468
- AlphaFoldDB: A0A178VMU7
- EnsemblPlants: AT3G04720.1
- Gramene: AT3G04720.1
- KEGG: ath:AT3G04720
- Orthologous matrix: ADKPYAW
- ExpressionAtlas: AT3G04720
- InterPro: IPR001002, IPR001153, IPR018226
- PANTHER: PTHR46351, PTHR46351:SF7
- SUPFAM: SSF50685, SSF57016
- PROSITE: PS00026, PS00771, PS00772
- Gene3D: 2.40.40.10, 3.30.60.10
- OrthoDB: A0A178VMU7
- SWISS-MODEL: A0A178VMU7
- Conserved Domain Database: cd00035, cd22777
Homologs
- Brachypodium distachyon Bradi2g47191
- Cucumis sativus CsChi23
- Medicago truncatula Medtr6g083270, Medtr6g083290
- Oryza sativa RCH10, CHIA1;175, Cht-3, Cht-2
- Panicum virgatum Pavir.1KG190500
Sequences
cDNA Sequence
- >AT3G04720.1
CGAAATTTCAATATACAGATATCTATATACAAATATTTAACCTACATGTGTGTATCATATGGTTTAAGCACGTTACCTGTAACGTATGTAATTAAATCAATTGCGTAGAATCACAAGAAAAACATTATTATATAATTAACTATTGATCCTATAATTTTATTATTTTCATATATATATAGATATATAGATAGATGCATTAGACCACCAAGAAAACAAAGACTTATCGATCATGAAGATCAGACTTAGCATAACCATCATACTTTTATCATACACAGTGGCTACGGTGGCCGGACAACAATGCGGTCGTCAAGGCGGTGGTCGAACTTGTCCCGGTAACATCTGCTGCAGTCAGTACGGTTACTGTGGTACCACCGCGGACTACTGTTCTCCGACCAACAACTGTCAGAGCAATTGTTGGGGAAGTGGGCCTAGCGGACCAGGGGAGAGCGCGTCGAACGTACGCGCCACCTACCATTTCTATAATCCGGCGCAGAATAATTGGGATTTGAGAGCCGTGAGTGCTTATTGCTCCACGTGGGATGCTGATAAGCCGTACGCATGGCGGAGCAAGTATGGCTGGACCGCCTTCTGCGGGCCGGCAGGACCTCGTGGTCAAGCTTCTTGCGGCAAGTGTTTAAGGGTGAAGAACACAAGAACAAATGCTGCAGTAACTGTGAGAATAGTGGACCAATGCAGCAACGGAGGCTTGGATTTGGATGTAGCAATGTTCAATCAAATAGACACCGATGGTTTTGGCTATCAACAAGGCCATCTCATTGTTGACTACCAATTTGTCGACTGTGGCAATGAGCTCATTGGGCAGCCTGATTCCAGAAACATGCTTGTTTCGGCCATTGATCGCGTTTGATATTATGTAATGATTTTGAGGTCAATATCGATCGGTCTACATAAAAATAATAAAGACCGCTATATATGTATTGTCGAGGGATATATGTTTCGTATCAATAAGGAAATTTTAAATATTATTATCATTCGATACGTACTACTTTAGTAAAATGAAAAAACTTCAACCGCCATGGAACGTGTAACAAACGACTTGAAACACCTAGCAAGAATAGTAAGTACATTGAATATTCAAAGGAAAGCCAAAGAAAATCATACGTACACAACGTG
CDS Sequence
- >AT3G04720.1
ATGAAGATCAGACTTAGCATAACCATCATACTTTTATCATACACAGTGGCTACGGTGGCCGGACAACAATGCGGTCGTCAAGGCGGTGGTCGAACTTGTCCCGGTAACATCTGCTGCAGTCAGTACGGTTACTGTGGTACCACCGCGGACTACTGTTCTCCGACCAACAACTGTCAGAGCAATTGTTGGGGAAGTGGGCCTAGCGGACCAGGGGAGAGCGCGTCGAACGTACGCGCCACCTACCATTTCTATAATCCGGCGCAGAATAATTGGGATTTGAGAGCCGTGAGTGCTTATTGCTCCACGTGGGATGCTGATAAGCCGTACGCATGGCGGAGCAAGTATGGCTGGACCGCCTTCTGCGGGCCGGCAGGACCTCGTGGTCAAGCTTCTTGCGGCAAGTGTTTAAGGGTGAAGAACACAAGAACAAATGCTGCAGTAACTGTGAGAATAGTGGACCAATGCAGCAACGGAGGCTTGGATTTGGATGTAGCAATGTTCAATCAAATAGACACCGATGGTTTTGGCTATCAACAAGGCCATCTCATTGTTGACTACCAATTTGTCGACTGTGGCAATGAGCTCATTGGGCAGCCTGATTCCAGAAACATGCTTGTTTCGGCCATTGATCGCGTTTGA
Protein Sequence
- >AT3G04720.1
MKIRLSITIILLSYTVATVAGQQCGRQGGGRTCPGNICCSQYGYCGTTADYCSPTNNCQSNCWGSGPSGPGESASNVRATYHFYNPAQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQASCGKCLRVKNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGFGYQQGHLIVDYQFVDCGNELIGQPDSRNMLVSAIDRV