Information report for AT2G44490
Gene Details
|
|
Functional Descriptions
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000084 — plant sperm cell — célula espermática o esperma (Spanish, exact), male gamete (exact), microgamete (exact), 植物精子細胞 (Japanese, exact), sperm nucleus (related), sperm cell (broad)
- CS66946 — Mutants are deficient in non-host resistance, manifested by increased penetration by Blumeria graminis compared to wild type.
- CS67133 — Cell death delayed and resistance compromised relative to the pen3-1 mutant upon infection with Erysiphe cichoracearum.
- CS67162 — PEN2-GFP complements the pen2 phenotype
- CS67818 — long roots and reducion in root hairs when grown on media supplemented with methyl jasmonate and ACC; fails to produce pollen at 22C, but is fertile at 16C.
- CS67819 — long roots and reducion in root hairs when grown on media supplemented with methyl jasmonate and ACC; fails to produce pollen at 22C, but is fertile at 16C.
- CS67820 — long roots and reducion in root hairs when grown on media supplemented with methyl jasmonate and ACC; fails to produce pollen at 22C, but is fertile at 16C.
- CS67821 — long roots and reducion in root hairs when grown on media supplemented with methyl jasmonate and ACC; fails to produce pollen at 22C, but is fertile at 16C.
- CS67822 — long roots and reducion in root hairs when grown on media supplemented with methyl jasmonate and ACC; fails to produce pollen at 22C, but is fertile at 16C.
- CS67823 — resistant to methyl jasmonate and ACC; transgene does not complement the altered methyl jasmonate or ACC response; fails to produce pollen at 22C, but is fertile at 16C.
- CS67824 — resistant to methyl jasmonate; transgene does not complement the altered methyl jasmonate response, but does complement the ACC response; fails to produce pollen at 22C, but is fertile at 16C.
- CS67825 — resistant to methyl jasmonate; transgene does not complement the altered methyl jasmonate response, but does complement the ACC response and partially restores fertility at 22C.
- CS9717 — broad-spectrum powdery mildew resistance
- pen2 — Increased susceptibility to fungal pathogens
- pen2-1 — permits efficient Blumeria graminis f. sp. hordei (Bgh) entry, initiation of postinvasive fungal growth invariably ceases, and this coincides with a cell death response of epidermal cells with haustorial complexes.
Functional Keywords
Literature and News
- Resources for targeted insertional and deletional mutagenesis in Arabidopsis. DOI: 10.1023/B:PLAN.0000009271.08420.d9 ; PMID: 14756312
- and postinvasion defenses both contribute to nonhost resistance in Arabidopsis. DOI: 10.1126/science.1119409 ; PMID: 16293760
- A glucosinolate metabolism pathway in living plant cells mediates broad-spectrum antifungal defense. DOI: 10.1126/science.1163732 ; PMID: 19095900
- Glucosinolate metabolites required for an Arabidopsis innate immune response. DOI: 10.1126/science.1164627 ; PMID: 19095898
- Functional genomic analysis of Arabidopsis thaliana glycoside hydrolase family 1. DOI: 10.1007/s11103-004-0790-1 ; PMID: 15604686
- The coi1-16 mutant harbors a second site mutation rendering PEN2 nonfunctional. DOI: 10.1105/tpc.107.056895 ; PMID: 18430804
- AGB1 and PMR5 contribute to PEN2-mediated preinvasion resistance to Magnaporthe oryzae in Arabidopsis thaliana. DOI: 10.1094/MPMI-22-11-1331 ; PMID: 19810803
- Mutation of a gene in the fungus Leptosphaeria maculans allows increased frequency of penetration of stomatal apertures of Arabidopsis thaliana. DOI: 10.1093/mp/ssn014 ; PMID: 19825554
- Innate immune responses activated in Arabidopsis roots by microbe-associated molecular patterns. DOI: 10.1105/tpc.109.069658 ; PMID: 20348432
- Tryptophan-derived secondary metabolites in Arabidopsis thaliana confer non-host resistance to necrotrophic Plectosphaerella cucumerina fungi. DOI: 10.1111/j.1365-313X.2010.04224.x ; PMID: 20408997
- Nonhost resistance to Magnaporthe oryzae in Arabidopsis thaliana. DOI: 10.4161/psb.5.6.11770 ; PMID: 20404515
- Entry mode-dependent function of an indole glucosinolate pathway in Arabidopsis for nonhost resistance against anthracnose pathogens. DOI: 10.1105/tpc.110.074344 ; PMID: 20605856
- Callose deposition: a multifaceted plant defense response. DOI: 10.1094/MPMI-07-10-0149 ; PMID: 20955078
- Arabidopsis ENHANCED DISEASE RESISTANCE 1 is required for pathogen-induced expression of plant defensins in nonhost resistance, and acts through interference of MYC2-mediated repressor function. DOI: 10.1111/j.1365-313X.2011.04651.x ; PMID: 21605210
- Roles of EDR1 in non-host resistance of Arabidopsis. DOI: 10.4161/psb.6.11.17494 ; PMID: 22057322
- Non-host resistance to penetration and hyphal growth of Magnaporthe oryzae in Arabidopsis. DOI: 10.1038/srep00171 ; PMID: 22355686
- UVR8 mediates UV-B-induced Arabidopsis defense responses against Botrytis cinerea by controlling sinapate accumulation. DOI: 10.1093/mp/sss025 ; PMID: 22447155
- Transcriptional activation and production of tryptophan-derived secondary metabolites in arabidopsis roots contributes to the defense against the fungal vascular pathogen Verticillium longisporum. DOI: 10.1093/mp/sss044 ; PMID: 22522512
- Metabolic and transcriptomic changes induced in Arabidopsis by the rhizobacterium Pseudomonas fluorescens SS101. DOI: 10.1104/pp.112.207324 ; PMID: 23073694
- The coronatine toxin of Pseudomonas syringae is a multifunctional suppressor of Arabidopsis defense. DOI: 10.1105/tpc.112.105312 ; PMID: 23204405
- Nonhost resistance of Arabidopsis thaliana against Alternaria alternata involves and postinvasive defenses but is collapsed by AAL-toxin in the absence of LOH2. DOI: 10.1094/PHYTO-08-12-0201-R ; PMID: 23360532
- UDP-glucosyltransferase UGT84A2/BRT1 is required for Arabidopsis nonhost resistance to the Asian soybean rust pathogen Phakopsora pachyrhizi. DOI: 10.1111/nph.12155 ; PMID: 23356583
- Glutathione and tryptophan metabolism are required for Arabidopsis immunity during the hypersensitive response to hemibiotrophs. DOI: 10.1073/pnas.1305745110 ; PMID: 23696664
- AtRbohF contributes to non-host resistance to Magnaporthe oryzae in Arabidopsis. DOI: 10.1271/bbb.130092 ; PMID: 23748772
- MPK6 contributes to non-host resistance to magnaporthe oryzae in Arabidopsis thaliana. DOI: 10.1271/bbb.130082 ; PMID: 23748771
- Penetration and post-penetration resistance to Magnaporthe oryzae in Arabidopsis. DOI: 10.1271/bbb.130213 ; PMID: 23924716
- Linking phytochrome to plant immunity: low red : far-red ratios increase Arabidopsis susceptibility to Botrytis cinerea by reducing the biosynthesis of indolic glucosinolates and camalexin. DOI: 10.1111/nph.13032 ; PMID: 25236170
- Mutations in the EDR1 Gene Alter the Response of Arabidopsis thaliana to Phytophthora infestans and the Bacterial PAMPs flg22 and elf18. DOI: 10.1094/MPMI-09-14-0282-R ; PMID: 25353364
- Classic myrosinase-dependent degradation of indole glucosinolate attenuates fumonisin B1-induced programmed cell death in Arabidopsis. DOI: 10.1111/tpj.12778 ; PMID: 25645692
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Immobilized Subpopulations of Leaf Epidermal Mitochondria Mediate PENETRATION2-Dependent Pathogen Entry Control in Arabidopsis. DOI: 10.1105/tpc.15.00887 ; PMID: 26721862
- Regulatory and Functional Aspects of Indolic Metabolism in Plant Systemic Acquired Resistance. DOI: 10.1016/j.molp.2016.01.005 ; PMID: 26802249
- ERECTA contributes to non-host resistance to Magnaporthe oryzae in Arabidopsis. DOI: 10.1080/09168451.2016.1151345 ; PMID: 26924213
- SOBIR1 contributes to non-host resistance to Magnaporthe oryzae in Arabidopsis. DOI: 10.1080/09168451.2016.1164586 ; PMID: 27023441
- Pathogen-Responsive MPK3 and MPK6 Reprogram the Biosynthesis of Indole Glucosinolates and Their Derivatives in Arabidopsis Immunity. DOI: 10.1105/tpc.15.00871 ; PMID: 27081184
- Dysfunction of Arabidopsis MACPF domain protein activates programmed cell death via tryptophan metabolism in MAMP-triggered immunity. DOI: 10.1111/tpj.13391 ; PMID: 27711985
- Role of the penetration-resistance genes PEN1, PEN2 and PEN3 in the hypersensitive response and race-specific resistance in Arabidopsis thaliana. DOI: 10.1111/tpj.12571 ; PMID: 24889055
- Components of the SNARE-containing regulon are co-regulated in root cells undergoing defense. DOI: 10.1080/15592324.2016.1274481 ; PMID: 28010187
- Glutathione Transferase U13 Functions in Pathogen-Triggered Glucosinolate Metabolism. DOI: 10.1104/pp.17.01455 ; PMID: 29122987
- A substrate of the ABC transporter PEN3 stimulates bacterial flagellin (flg22)-induced callose deposition in Arabidopsis thaliana. DOI: 10.1074/jbc.RA119.007676 ; PMID: 30833326
- The role of CYP71A12 monooxygenase in pathogen-triggered tryptophan metabolism and Arabidopsis immunity. DOI: 10.1111/nph.16118 ; PMID: 31411742
- CCA1 and LHY contribute to nonhost resistance to Pyricularia oryzae (syn. Magnaporthe oryzae) in Arabidopsis thaliana. DOI: 10.1080/09168451.2019.1660612 ; PMID: 31478783
- De novo indol-3-ylmethyl glucosinolate biosynthesis, and not long-distance transport, contributes to defence of Arabidopsis against powdery mildew. DOI: 10.1111/pce.13766 ; PMID: 32275065
- Foliar resistance to Rhizoctonia solani in Arabidopsis is compromised by simultaneous loss of ethylene, jasmonate and PEN2 mediated defense pathways. DOI: 10.1038/s41598-021-81858-5 ; PMID: 33510286
- Epidermal chloroplasts are defense-related motile organelles equipped with plant immune components. DOI: 10.1038/s41467-021-22977-5 ; PMID: 34016974
- Multiple indole glucosinolates and myrosinases defend Arabidopsis against Tetranychus urticae herbivory. DOI: 10.1093/plphys/kiab247 ; PMID: 34618148
- Preinvasive nonhost resistance of Arabidopsis against melanized appressorium-mediated entry of multiple nonadapted Colletotrichum fungi. DOI: 10.1080/15592324.2021.2018218 ; PMID: 34978264
- Epidermal CCA1 and PMR5 contribute to nonhost resistance in Arabidopsis. DOI: 10.1093/bbb/zbac160 ; PMID: 36149326
- Proteomic study of the Arabidopsis thaliana chloroplastic envelope membrane utilizing alternatives to traditional two-dimensional electrophoresis. DOI: 10.1021/pr034025j ; PMID: 12938931
- and postinvasion defenses both contribute to nonhost resistance in Arabidopsis. DOI: 10.1126/science.1119409 ; PMID: 16293760
- The PHYTOCHROME C photoreceptor gene mediates natural variation in flowering and growth responses of Arabidopsis thaliana. DOI: 10.1038/ng1818 ; PMID: 16732287
- ABA is an essential signal for plant resistance to pathogens affecting JA biosynthesis and the activation of defenses in Arabidopsis. DOI: 10.1105/tpc.106.048041 ; PMID: 17513501
- PYK10, a beta-glucosidase located in the endoplasmatic reticulum, is crucial for the beneficial interaction between Arabidopsis thaliana and the endophytic fungus Piriformospora indica. DOI: 10.1111/j.1365-313X.2008.03424.x ; PMID: 18248598
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Gene Resources
- UniProt: A0A654F728
- EMBL: CACRSJ010000105, CACSHJ010000088
- AlphaFoldDB: A0A654F728
- EnsemblPlants: AT2G44490.1
- Gramene: AT2G44490.1
- KEGG: ath:AT2G44490
- Orthologous matrix: CTMNEPW
- ExpressionAtlas: AT2G44490
- InterPro: IPR001360, IPR017853, IPR033132
- PANTHER: PTHR10353, PTHR10353:SF226
- SUPFAM: SSF51445
- PROSITE: PS00653
- Gene3D: 3.20.20.80
- OrthoDB: A0A654F728
- SWISS-MODEL: A0A654F728
Homologs
Sequences
cDNA Sequence
- >AT2G44490.1
TAAAAATCCCATAAAAAAATAATTGTAATCCTAGTTTGACTTCTCAATTCTCTGCATCTCTCAATCACGCATTTATATATCATATCATTCAAGCCTTTTTATCTTAGTGTCTCTCTATAACCAGAGAAATTATTTCAAGATCTACTTCTCATCATCGTTCTTTTCTTATCTCTTCTTGTCCAACTTCTTCTGAATCAAGACAAGAGAAAAGCAACCAAAGATGGCACATCTTCAAAGAACATTTCCTACTGAGATGTCAAAAGGTAGAGCTAGCTTTCCAAAAGGCTTTCTCTTTGGAACTGCTTCATCTTCTTATCAGTACGAAGGAGCAGTGAATGAAGGTGCGAGAGGACAAAGCGTGTGGGATCATTTCTCCAACAGGTTTCCTCACAGAATCAGTGATTCTAGCGACGGAAACGTTGCCGTTGATTTCTACCATCGTTACAAGGAAGATATTAAGAGAATGAAGGATATAAACATGGATTCGTTTCGGCTTTCCATTGCTTGGCCACGAGTTCTACCTTATGGCAAAAGGGATAGAGGAGTTAGTGAAGAAGGAATTAAGTTTTACAATGATGTTATTGATGAACTCTTAGCCAATGAAATCACTCCTCTTGTTACTATCTTTCATTGGGACATACCACAGGATCTTGAAGATGAATACGGCGGTTTTCTAAGCGAGCAGATTATAGATGACTTCAGAGACTATGCGAGTCTCTGCTTCGAGAGATTTGGGGACAGAGTGAGTCTGTGGTGCACAATGAATGAGCCGTGGGTCTACAGTGTCGCGGGCTATGACACAGGAAGGAAAGCGCCAGGACGGTGCTCCAAGTATGTTAATGGCGCTAGTGTTGCTGGAATGTCGGGATACGAGGCATATATTGTGAGCCATAACATGCTTCTAGCGCACGCAGAAGCAGTGGAAGTGTTTAGAAAATGTGACCATATTAAAAACGGACAAATTGGGATTGCGCATAATCCACTTTGGTACGAGCCATATGATCCGAGTGATCCAGATGATGTCGAAGGATGTAATCGAGCTATGGACTTCATGCTTGGTTGGCATCAGCATCCGACTGCTTGTGGAGACTATCCAGAAACGATGAAGAAATCAGTTGGAGATAGATTACCGAGTTTTACACCAGAACAATCTAAGAAACTTATAGGCTCTTGCGATTACGTTGGTATAAACTACTATAGCTCGCTTTTCGTGAAGAGTATCAAACACGTGGATCCTACGCAACCTACTTGGAGAACTGACCAAGGCGTTGATTGGATGAAAACCAACATAGATGGGAAACAAATAGCAAAACAAGGAGGATCAGAGTGGAGTTTCACATATCCAACAGGACTCAGAAACATTTTGAAGTATGTGAAAAAAACTTATGGCAATCCTCCCATTCTCATAACTGAAAACGGGTATGGTGAAGTAGCGGAACAGAGTCAGAGTCTTTATATGTACAATCCTTCAATCGACACAGAGAGATTGGAGTACATTGAAGGACATATCCACGCTATTCATCAAGCCATCCATGAAGATGGAGTAAGAGTGGAAGGTTATTACGTATGGTCATTGCTAGATAACTTCGAGTGGAACAGTGGATATGGTGTGAGATATGGTTTATATTACATTGATTACAAAGATGGGCTTAGACGATACCCGAAAATGTCGGCGTTATGGTTGAAAGAGTTCTTGAGGTTTGATCAAGAAGACGATTCTTCGACGTCTAAGAAAGAAGAGAAGAAAGAGAGCTATGGAAAACAGTTATTGCATTCTGTTCAGGACAGTCAATTTGTTCATTCGATTAAAGACAGTGGTGCGTTACCTGCGGTTTTGGGGAGCTTGTTCGTTGTGTCTGCAACTGTTGGTACTTCTCTGTTCTTCAAAGGAGCTAATAATTGAAACAGAAGAAACAAAATTTTAAAAAATTGTTGGGATTTGTTGTTGTTCTTGAAAGATTGAAAAAGAACTATGTGATACTTTGTACTATTCTTTTCTATAATTTATTGTGTGTTTTGTTATTGAAAACTTGTGTGGTCTATTAGTTGAGAAAGATTCAGTGTCTCCCAAGTTAGCGAGTGTATTTTACTGAAGCTGTTTATATGTGCCTGAACGATCGGCCCTTTAAGTAGTTCCTAAAACTAGCCCATATTTAGTGATCTCATTATTCGTTATCCTCTGTAATTCAATTTCCACATTGAAAAATTAGGCCTAGTCTCATA
CDS Sequence
- >AT2G44490.1
ATGGCACATCTTCAAAGAACATTTCCTACTGAGATGTCAAAAGGTAGAGCTAGCTTTCCAAAAGGCTTTCTCTTTGGAACTGCTTCATCTTCTTATCAGTACGAAGGAGCAGTGAATGAAGGTGCGAGAGGACAAAGCGTGTGGGATCATTTCTCCAACAGGTTTCCTCACAGAATCAGTGATTCTAGCGACGGAAACGTTGCCGTTGATTTCTACCATCGTTACAAGGAAGATATTAAGAGAATGAAGGATATAAACATGGATTCGTTTCGGCTTTCCATTGCTTGGCCACGAGTTCTACCTTATGGCAAAAGGGATAGAGGAGTTAGTGAAGAAGGAATTAAGTTTTACAATGATGTTATTGATGAACTCTTAGCCAATGAAATCACTCCTCTTGTTACTATCTTTCATTGGGACATACCACAGGATCTTGAAGATGAATACGGCGGTTTTCTAAGCGAGCAGATTATAGATGACTTCAGAGACTATGCGAGTCTCTGCTTCGAGAGATTTGGGGACAGAGTGAGTCTGTGGTGCACAATGAATGAGCCGTGGGTCTACAGTGTCGCGGGCTATGACACAGGAAGGAAAGCGCCAGGACGGTGCTCCAAGTATGTTAATGGCGCTAGTGTTGCTGGAATGTCGGGATACGAGGCATATATTGTGAGCCATAACATGCTTCTAGCGCACGCAGAAGCAGTGGAAGTGTTTAGAAAATGTGACCATATTAAAAACGGACAAATTGGGATTGCGCATAATCCACTTTGGTACGAGCCATATGATCCGAGTGATCCAGATGATGTCGAAGGATGTAATCGAGCTATGGACTTCATGCTTGGTTGGCATCAGCATCCGACTGCTTGTGGAGACTATCCAGAAACGATGAAGAAATCAGTTGGAGATAGATTACCGAGTTTTACACCAGAACAATCTAAGAAACTTATAGGCTCTTGCGATTACGTTGGTATAAACTACTATAGCTCGCTTTTCGTGAAGAGTATCAAACACGTGGATCCTACGCAACCTACTTGGAGAACTGACCAAGGCGTTGATTGGATGAAAACCAACATAGATGGGAAACAAATAGCAAAACAAGGAGGATCAGAGTGGAGTTTCACATATCCAACAGGACTCAGAAACATTTTGAAGTATGTGAAAAAAACTTATGGCAATCCTCCCATTCTCATAACTGAAAACGGGTATGGTGAAGTAGCGGAACAGAGTCAGAGTCTTTATATGTACAATCCTTCAATCGACACAGAGAGATTGGAGTACATTGAAGGACATATCCACGCTATTCATCAAGCCATCCATGAAGATGGAGTAAGAGTGGAAGGTTATTACGTATGGTCATTGCTAGATAACTTCGAGTGGAACAGTGGATATGGTGTGAGATATGGTTTATATTACATTGATTACAAAGATGGGCTTAGACGATACCCGAAAATGTCGGCGTTATGGTTGAAAGAGTTCTTGAGGTTTGATCAAGAAGACGATTCTTCGACGTCTAAGAAAGAAGAGAAGAAAGAGAGCTATGGAAAACAGTTATTGCATTCTGTTCAGGACAGTCAATTTGTTCATTCGATTAAAGACAGTGGTGCGTTACCTGCGGTTTTGGGGAGCTTGTTCGTTGTGTCTGCAACTGTTGGTACTTCTCTGTTCTTCAAAGGAGCTAATAATTGA
Protein Sequence
- >AT2G44490.1
MAHLQRTFPTEMSKGRASFPKGFLFGTASSSYQYEGAVNEGARGQSVWDHFSNRFPHRISDSSDGNVAVDFYHRYKEDIKRMKDINMDSFRLSIAWPRVLPYGKRDRGVSEEGIKFYNDVIDELLANEITPLVTIFHWDIPQDLEDEYGGFLSEQIIDDFRDYASLCFERFGDRVSLWCTMNEPWVYSVAGYDTGRKAPGRCSKYVNGASVAGMSGYEAYIVSHNMLLAHAEAVEVFRKCDHIKNGQIGIAHNPLWYEPYDPSDPDDVEGCNRAMDFMLGWHQHPTACGDYPETMKKSVGDRLPSFTPEQSKKLIGSCDYVGINYYSSLFVKSIKHVDPTQPTWRTDQGVDWMKTNIDGKQIAKQGGSEWSFTYPTGLRNILKYVKKTYGNPPILITENGYGEVAEQSQSLYMYNPSIDTERLEYIEGHIHAIHQAIHEDGVRVEGYYVWSLLDNFEWNSGYGVRYGLYYIDYKDGLRRYPKMSALWLKEFLRFDQEDDSSTSKKEEKKESYGKQLLHSVQDSQFVHSIKDSGALPAVLGSLFVVSATVGTSLFFKGANN