Information report for AT2G43790
Gene Details
|
|
Functional Descriptions
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000084 — plant sperm cell — célula espermática o esperma (Spanish, exact), male gamete (exact), microgamete (exact), 植物精子細胞 (Japanese, exact), sperm nucleus (related), sperm cell (broad)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- GO:0010150 — involved in — leaf senescence
- GO:2000037 — acts upstream of or within — regulation of stomatal complex patterning
- GO:0005515 — enables — protein binding
- GO:0010120 — acts upstream of or within — camalexin biosynthetic process
- GO:0009737 — acts upstream of or within — response to abscisic acid
- GO:0051510 — involved in — regulation of unidimensional cell growth
- GO:0050826 — acts upstream of or within — response to freezing
- GO:0005938 — located in — cell cortex
- GO:0010229 — acts upstream of or within — inflorescence development
- GO:0009864 — acts upstream of or within — induced systemic resistance, jasmonic acid mediated signaling pathway
- GO:0048481 — acts upstream of or within — plant ovule development
- GO:0009738 — involved in — abscisic acid-activated signaling pathway
- GO:0010183 — acts upstream of or within — pollen tube guidance
- GO:0009409 — acts upstream of or within — response to cold
- GO:0004674 — enables — protein serine/threonine kinase activity
- GO:0051301 — acts upstream of or within — cell division
- GO:0005829 — located in — cytosol
- GO:0005737 — is active in — cytoplasm
- GO:0009524 — located in — phragmoplast
- GO:0009723 — acts upstream of or within — response to ethylene
- GO:0000302 — acts upstream of or within — response to reactive oxygen species
- GO:0006468 — acts upstream of or within — protein phosphorylation
- GO:0009574 — located in — preprophase band
- GO:0009651 — acts upstream of or within — response to salt stress
- GO:0080136 — acts upstream of or within — priming of cellular response to stress
- GO:0009620 — involved in — response to fungus
- GO:0005802 — located in — trans-Golgi network
- GO:0042542 — acts upstream of or within — response to hydrogen peroxide
- GO:0005634 — located in — nucleus
- GO:0016310 — has protein modification of type — phosphorylation
- GO:1902065 — acts upstream of or within — response to L-glutamate
- GO:0042742 — acts upstream of or within — defense response to bacterium
- GO:0019902 — enables — phosphatase binding
- GO:0004707 — enables — MAP kinase activity
- GO:0048364 — acts upstream of or within — root development
- GO:0009555 — acts upstream of or within — pollen development
- GO:0004672 — enables — protein kinase activity
- GO:0006979 — acts upstream of or within — response to oxidative stress
- GO:0005634 — is active in — nucleus
- GO:0010224 — acts upstream of or within — response to UV-B
- GO:0010082 — involved in — regulation of root meristem growth
- GO:0035556 — involved in — intracellular signal transduction
- GO:0006970 — acts upstream of or within — response to osmotic stress
- GO:0051301 — involved in — cell division
- GO:2000038 — acts upstream of or within — regulation of stomatal complex development
- GO:0090333 — involved in — regulation of stomatal closure
- GO:0007165 — acts upstream of or within — signal transduction
- CS31099 — No visible mutant phenotype.
- CS71691 — No visible phenotype
- SALK_062471C — Reduced fertility; silique length is shorter than the wild type; embryo was found to be protruding out of the dried seed coat; approximately 10% of the seed produced display this protruding embryo phenotype.
- mpk6-1 — Defects in root development. Short roots and sometimes even no roots.Ectopic cell divisions in the roots and disorganized cells and cell files.
- mpk6-2 — Defects in root development. Short roots and sometimes even no roots.Ectopic cell divisions in the roots and disorganized cells and cell files.
- mpk6-2 — Less sensitive to l-Glu treatments, displayed longer primary roots when treated with l-Glu as compared to wt.l-Glu slightly decreases the number of mitotic cells, minor effect on starch grain production, as well as on the overall structure of the root cap.
- mpk6-3 — Defects in root development. Short roots and sometimes even no roots.Ectopic cell divisions in the roots and disorganized cells and cell files.
- mpk6-3/mpk3-1 — Female sterile. Integuments undergo early cell division arrest, as a result, the embryo sac becomes constricted and protrudes from the micropyle.
Functional Keywords
Literature and News
- Functional analysis of oxidative stress-activated mitogen-activated protein kinase cascade in plants. DOI: 10.1073/pnas.97.6.2940 ; PMID: 10717008
- Microbial elicitors induce activation and dual phosphorylation of the Arabidopsis thaliana MAPK 6. DOI: 10.1074/jbc.275.11.7521 ; PMID: 10713056
- Various abiotic stresses rapidly activate Arabidopsis MAP kinases ATMPK4 and ATMPK6. DOI: 10.1046/j.1365-313x.2000.00913.x ; PMID: 11123804
- MAP kinase signalling cascade in Arabidopsis innate immunity. DOI: 10.1038/415977a ; PMID: 11875555
- Oxidative stress activates ATMPK6, an Arabidopsis homologue of MAP kinase. DOI: 10.1093/pcp/pce123 ; PMID: 11577197
- Mapping out the roles of MAP kinases in plant defense. DOI: 10.1016/s1360-1385(01)02058-1 ; PMID: 11544109
- Harpin induces activation of the Arabidopsis mitogen-activated protein kinases AtMPK4 and AtMPK6. DOI: 10.1104/pp.126.4.1579 ; PMID: 11500556
- Different protein kinase families are activated by osmotic stresses in Arabidopsis thaliana cell suspensions. Involvement of the MAP kinases AtMPK3 and AtMPK6. DOI: 10.1016/s0014-5793(02)03162-9 ; PMID: 12220631
- NDP kinase 2 interacts with two oxidative stress-activated MAPKs to regulate cellular redox state and enhances multiple stress tolerance in transgenic plants. DOI: 10.1073/pnas.252641899 ; PMID: 12506203
- Distinct regulation of salinity and genotoxic stress responses by Arabidopsis MAP kinase phosphatase 1. DOI: 10.1093/emboj/cdf646 ; PMID: 12456655
- Mitogen-activated protein kinase cascades in plants: a new nomenclature. DOI: 10.1016/s1360-1385(02)02302-6 ; PMID: 12119167
- A MAPK pathway mediates ethylene signaling in plants. DOI: 10.1093/emboj/cdg131 ; PMID: 12628921
- OXI1 kinase is necessary for oxidative burst-mediated signalling in Arabidopsis. DOI: 10.1038/nature02353 ; PMID: 14985766
- Silencing of the mitogen-activated protein kinase MPK6 compromises disease resistance in Arabidopsis. DOI: 10.1105/tpc.015552 ; PMID: 15020743
- The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. DOI: 10.1016/j.molcel.2004.06.023 ; PMID: 15225555
- Identification of nine sucrose nonfermenting 1-related protein kinases 2 activated by hyperosmotic and saline stresses in Arabidopsis thaliana. DOI: 10.1074/jbc.M405259200 ; PMID: 15292193
- Involvement of MPK4 in osmotic stress response pathways in cell suspensions and plantlets of Arabidopsis thaliana: activation by hypoosmolarity and negative role in hyperosmolarity tolerance. DOI: 10.1016/j.febslet.2004.08.001 ; PMID: 15358537
- High humidity suppresses ssi4-mediated cell death and disease resistance upstream of MAP kinase activation, H2O2 production and defense gene expression. DOI: 10.1111/j.1365-313X.2004.02180.x ; PMID: 15341634
- Stress hormone-independent activation and nuclear translocation of mitogen-activated protein kinases in Arabidopsis thaliana during ozone exposure. DOI: 10.1111/j.1365-313X.2004.02229.x ; PMID: 15500467
- Phosphorylation of 1-aminocyclopropane-1-carboxylic acid synthase by MPK6, a stress-responsive mitogen-activated protein kinase, induces ethylene biosynthesis in Arabidopsis. DOI: 10.1105/tpc.104.026609 ; PMID: 15539472
- RNA interference-based (RNAi) suppression of AtMPK6, an Arabidopsis mitogen-activated protein kinase, results in hypersensitivity to ozone and misregulation of AtMPK3. DOI: 10.1016/j.envpol.2005.04.017 ; PMID: 15964670
- High throughput identification of potential Arabidopsis mitogen-activated protein kinases substrates. DOI: 10.1074/mcp.M500007-MCP200 ; PMID: 16009969
- Involvement of PPS3 phosphorylated by elicitor-responsive mitogen-activated protein kinases in the regulation of plant cell death. DOI: 10.1104/pp.105.066795 ; PMID: 16306147
- The Arabidopsis MAP kinase kinase MKK1 participates in defence responses to the bacterial elicitor flagellin. DOI: 10.1111/j.1365-313X.2006.02888.x ; PMID: 17059410
- A Mitogen-activated protein kinase kinase kinase mediates reactive oxygen species homeostasis in Arabidopsis. DOI: 10.1074/jbc.M605293200 ; PMID: 17043356
- MEKK1 is required for MPK4 activation and regulates tissue-specific and temperature-dependent cell death in Arabidopsis. DOI: 10.1074/jbc.M605319200 ; PMID: 17023433
- MEKK1 is required for flg22-induced MPK4 activation in Arabidopsis plants. DOI: 10.1104/pp.106.091389 ; PMID: 17142480
- Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis. DOI: 10.1105/tpc.106.048298 ; PMID: 17259259
- The mitogen-activated protein kinase cascade MKK3-MPK6 is an important part of the jasmonate signal transduction pathway in Arabidopsis. DOI: 10.1105/tpc.106.046581 ; PMID: 17369371
- Mutational evidence that the Arabidopsis MAP kinase MPK6 is involved in anther, inflorescence, and embryo development. DOI: 10.1093/jxb/erm092 ; PMID: 17519351
- The MAP kinase kinase MKK2 affects disease resistance in Arabidopsis. DOI: 10.1094/MPMI-20-5-0589 ; PMID: 17506336
- Arabidopsis MAPK phosphatase 2 (MKP2) positively regulates oxidative stress tolerance and inactivates the MPK3 and MPK6 MAPKs. DOI: 10.1074/jbc.M701888200 ; PMID: 17586809
- The PP2C-type phosphatase AP2C1, which negatively regulates MPK4 and MPK6, modulates innate immunity, jasmonic acid, and ethylene levels in Arabidopsis. DOI: 10.1105/tpc.106.049585 ; PMID: 17630279
- The Arabidopsis mitogen-activated protein kinase kinase MKK3 is upstream of group C mitogen-activated protein kinases and participates in pathogen signaling. DOI: 10.1105/tpc.106.050039 ; PMID: 17933903
- MAPK phosphorylation-induced stabilization of ACS6 protein is mediated by the non-catalytic C-terminal domain, which also contains the cis-determinant for rapid degradation by the 26S proteasome pathway. DOI: 10.1111/j.1365-313X.2008.03404.x ; PMID: 18182027
- Signaling pathways mediating the suppression of Arabidopsis thaliana Ku gene expression by abscisic acid. DOI: 10.1016/j.bbagrm.2007.12.005 ; PMID: 18179780
- An Arabidopsis protein phosphorylated in response to microbial elicitation, AtPHOS32, is a substrate of MAP kinases 3 and 6. DOI: 10.1074/jbc.M800735200 ; PMID: 18285339
- AtMKK1 mediates ABA-induced CAT1 expression and H2O2 production via AtMPK6-coupled signaling in Arabidopsis. DOI: 10.1111/j.1365-313X.2008.03433.x ; PMID: 18248592
- Haplo-insufficiency of MPK3 in MPK6 mutant background uncovers a novel function of these two MAPKs in Arabidopsis ovule development. DOI: 10.1105/tpc.108.058032 ; PMID: 18364464
- The wheat mitogen-activated protein kinases TaMPK3 and TaMPK6 are differentially regulated at multiple levels during compatible disease interactions with Mycosphaerella graminicola. DOI: 10.1104/pp.108.119511 ; PMID: 18441220
- A fungal-responsive MAPK cascade regulates phytoalexin biosynthesis in Arabidopsis. DOI: 10.1073/pnas.0711301105 ; PMID: 18378893
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Activation of MAPK kinase 9 induces ethylene and camalexin biosynthesis and enhances sensitivity to salt stress in Arabidopsis. DOI: 10.1074/jbc.M801392200 ; PMID: 18693252
- Regulation of floral organ abscission in Arabidopsis thaliana. DOI: 10.1073/pnas.0805539105 ; PMID: 18809915
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- Arabidopsis stomatal initiation is controlled by MAPK-mediated regulation of the bHLH SPEECHLESS. DOI: 10.1126/science.1162263 ; PMID: 19008449
- Mitogen-activated protein kinase cascades and ethylene: signaling, biosynthesis, or both? DOI: 10.1104/pp.108.132241 ; PMID: 19109412
- Mitogen-activated protein kinases 3 and 6 are required for full priming of stress responses in Arabidopsis thaliana. DOI: 10.1105/tpc.108.062158 ; PMID: 19318610
- An arabidopsis mitogen-activated protein kinase cascade, MKK9-MPK6, plays a role in leaf senescence. DOI: 10.1104/pp.108.133439 ; PMID: 19251906
- A cell wall extract from the endophytic fungus Piriformospora indica promotes growth of Arabidopsis seedlings and induces intracellular calcium elevation in roots. DOI: 10.1111/j.1365-313X.2009.03867.x ; PMID: 19392691
- Flg22 regulates the release of an ethylene response factor substrate from MAP kinase 6 in Arabidopsis thaliana via ethylene signaling. DOI: 10.1073/pnas.0810206106 ; PMID: 19416906
- A Pseudomonas syringae effector inactivates MAPKs to suppress PAMP-induced immunity in plants. DOI: 10.1016/j.chom.2007.03.006 ; PMID: 18005697
- Dual control of nuclear EIN3 by bifurcate MAPK cascades in C2H4 signalling. DOI: 10.1038/nature06543 ; PMID: 18273012
- Ethylene signaling is required for the acceleration of cell death induced by the activation of AtMEK5 in Arabidopsis. DOI: 10.1038/cr.2008.29 ; PMID: 18268539
- AtMKK1 and AtMPK6 are involved in abscisic acid and sugar signaling in Arabidopsis seed germination. DOI: 10.1007/s11103-009-9503-0 ; PMID: 19484493
- Cell fate transitions during stomatal development. DOI: 10.1002/bies.200800231 ; PMID: 19565615
- The Arabidopsis MAP kinase kinase 7: A crosstalk point between auxin signaling and defense responses? DOI: 10.4161/psb.3.4.5230 ; PMID: 19704652
- A Novel MAPKK Involved in Cell Death and Defense Signaling. DOI: 10.4161/psb.2.5.4267 ; PMID: 19704612
- Arabidopsis MPK6 is involved in cell division plane control during early root development, and localizes to the pre-prophase band, phragmoplast, trans-Golgi network and plasma membrane. DOI: 10.1111/j.1365-313X.2009.04046.x ; PMID: 19832943
- Suppression of MKK5 reduces ozone-induced signal transmission to both MPK3 and MPK6 and confers increased ozone sensitivity in Arabidopsis thaliana. DOI: 10.4161/psb.4.8.9298 ; PMID: 19820329
- Sometimes new results raise new questions: the question marks between mitogen-activated protein kinase and ethylene signaling. DOI: 10.1073/pnas.0810206106 ; PMID: 19820303
- Quantitative proteomics identifies oxidant-induced, AtMPK6-dependent changes in Arabidopsis thaliana protein profiles. DOI: 10.4161/psb.4.6.8538 ; PMID: 19816138
- The missing link?: Arabidopsis SPCH is a MAPK specificity factor that controls entry into the stomatal lineage. DOI: 10.4161/psb.4.5.8296 ; PMID: 19816100
- MAP kinase phosphatase1 and protein tyrosine phosphatase1 are repressors of salicylic acid synthesis and SNC1-mediated responses in Arabidopsis. DOI: 10.1105/tpc.109.067678 ; PMID: 19789277
- Regulation of Arabidopsis early anther development by the mitogen-activated protein kinases, MPK3 and MPK6, and the ERECTA and related receptor-like kinases. DOI: 10.1093/mp/ssn029 ; PMID: 19825569
- Cadmium activates Arabidopsis MPK3 and MPK6 via accumulation of reactive oxygen species. DOI: 10.1016/j.phytochem.2010.01.005 ; PMID: 20116811
- A mitogen-activated protein kinase, AhMPK6 from peanut localizes to the nucleus and also induces defense responses upon transient expression in tobacco. DOI: 10.1016/j.plaphy.2010.03.010 ; PMID: 20409725
- The Ca(2+) -dependent protein kinase CPK3 is required for MAPK-independent salt-stress acclimation in Arabidopsis. DOI: 10.1111/j.1365-313X.2010.04257.x ; PMID: 20497378
- Activation of a mitogen-activated protein kinase pathway in Arabidopsis by chitin. DOI: 10.1111/j.1364-3703.2004.00215.x ; PMID: 20565589
- Mitogen-activated protein kinase 3 and 6 regulate Botrytis cinerea-induced ethylene production in Arabidopsis. DOI: 10.1111/j.1365-313X.2010.04318.x ; PMID: 20659280
- MAPK phosphatase MKP2 mediates disease responses in Arabidopsis and functionally interacts with MPK3 and MPK6. DOI: 10.1111/j.1365-313X.2010.04297.x ; PMID: 20626661
- Phosphatidic acid mediates salt stress response by regulation of MPK6 in Arabidopsis thaliana. DOI: 10.1111/j.1469-8137.2010.03422.x ; PMID: 20796215
- Hydrogen peroxide-mediated activation of MAP kinase 6 modulates nitric oxide biosynthesis and signal transduction in Arabidopsis. DOI: 10.1105/tpc.109.072959 ; PMID: 20870959
- Regulation of MAPK signaling and cell death by MAPK phosphatase MKP2. DOI: 10.4161/psb.5.11.13645 ; PMID: 21057191
- MAMP-responsive MAPK cascades regulate phytoalexin biosynthesis. DOI: 10.4161/psb.5.12.13982 ; PMID: 21150304
- MAPK phosphatase AP2C3 induces ectopic proliferation of epidermal cells leading to stomata development in Arabidopsis. DOI: 10.1371/journal.pone.0015357 ; PMID: 21203456
- The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases. DOI: 10.1111/j.1742-4658.2011.08033.x ; PMID: 21276203
- Arabidopsis MAP Kinase Phosphatase 1 (AtMKP1) negatively regulates MPK6-mediated PAMP responses and resistance against bacteria. DOI: 10.1111/j.1365-313X.2011.04588.x ; PMID: 21447069
- Arabidopsis MAP kinase phosphatase 1 is phosphorylated and activated by its substrate AtMPK6. DOI: 10.1007/s00299-011-1064-4 ; PMID: 21455789
- Phosphorylation of a WRKY transcription factor by two pathogen-responsive MAPKs drives phytoalexin biosynthesis in Arabidopsis. DOI: 10.1105/tpc.111.084996 ; PMID: 21498677
- Autophosphorylation profiling of Arabidopsis protein kinases using the cell-free system. DOI: 10.1016/j.phytochem.2011.02.029 ; PMID: 21477822
- Phosphorylation by MPK6: a conserved transcriptional modification mediates nitrate reductase activation and NO production? DOI: 10.4161/psb.6.6.15308 ; PMID: 21593598
- Lipase activity in insect oral secretions mediates defense responses in Arabidopsis. DOI: 10.1104/pp.111.173567 ; PMID: 21546453
- MPK6, sphinganine and the LCB2a gene from serine palmitoyltransferase are required in the signaling pathway that mediates cell death induced by long chain bases in Arabidopsis. DOI: 10.1111/j.1469-8137.2011.03727.x ; PMID: 21534970
- Arabidopsis MAP kinase phosphatase 1 and its target MAP kinases 3 and 6 antagonistically determine UV-B stress tolerance, independent of the UVR8 photoreceptor pathway. DOI: 10.1111/j.1365-313X.2011.04725.x ; PMID: 21790814
- Expression analysis of MAP2K9 and MAPK6 during pathogenesis of Alternaria blight in Arabidopsis thaliana ecotype Columbia. DOI: 10.1007/s11033-011-1232-1 ; PMID: 21947882
- N-acyl-homoserine lactone confers resistance toward biotrophic and hemibiotrophic pathogens via altered activation of AtMPK6. DOI: 10.1104/pp.111.180604 ; PMID: 21940998
- Arabidopsis MKKK20 is involved in osmotic stress response via regulation of MPK6 activity. DOI: 10.1007/s00299-011-1157-0 ; PMID: 21969089
- Transient MPK6 activation in response to oxygen deprivation and reoxygenation is mediated by mitochondria and aids seedling survival in Arabidopsis. DOI: 10.1007/s11103-011-9850-5 ; PMID: 22086331
- Alkamides activate jasmonic acid biosynthesis and signaling pathways and confer resistance to Botrytis cinerea in Arabidopsis thaliana. DOI: 10.1371/journal.pone.0027251 ; PMID: 22076141
- Activation of the Arabidopsis thaliana mitogen-activated protein kinase MPK11 by the flagellin-derived elicitor peptide, flg22. DOI: 10.1094/MPMI-11-11-0281 ; PMID: 22204645
- A dominant allele of Arabidopsis pectin-binding wall-associated kinase induces a stress response suppressed by MPK6 but not MPK3 mutations. DOI: 10.1093/mp/ssr096 ; PMID: 22155845
- Identification of a C2H2-type zinc finger transcription factor (ZAT10) from Arabidopsis as a substrate of MAP kinase. DOI: 10.1007/s00299-011-1192-x ; PMID: 22134874
- or flagellin-induced resistance against Botrytis cinerea. DOI: 10.1104/pp.111.174003 ; PMID: 21803860
- Phytosphingosine-phosphate is a signal for AtMPK6 activation and Arabidopsis response to chilling. DOI: 10.1111/j.1469-8137.2011.04017.x ; PMID: 22236066
- A MAP kinase kinase interacts with SymRK and regulates nodule organogenesis in Lotus japonicus. DOI: 10.1105/tpc.112.095984 ; PMID: 22353370
- Dehydration stress activates Arabidopsis MPK6 to signal DCP1 phosphorylation. DOI: 10.1038/emboj.2012.56 ; PMID: 22407295
- Reactive oxygen species as transducers of sphinganine-mediated cell death pathway. DOI: 10.4161/psb.6.10.16981 ; PMID: 21921699
- MAP Kinase 6-mediated activation of vacuolar processing enzyme modulates heat shock-induced programmed cell death in Arabidopsis. DOI: 10.1111/j.1469-8137.2012.04131.x ; PMID: 22497243
- Determination of primary sequence specificity of Arabidopsis MAPKs MPK3 and MPK6 leads to identification of new substrates. DOI: 10.1042/BJ20111809 ; PMID: 22631074
- Nitric oxide promotes MPK6-mediated caspase-3-like activation in cadmium-induced Arabidopsis thaliana programmed cell death. DOI: 10.1111/j.1365-3040.2012.02543.x ; PMID: 22621159
- Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis. DOI: 10.1016/j.bbrc.2012.04.137 ; PMID: 22575450
- Over-expression of Arabidopsis Bax inhibitor-1 delays methyl jasmonate-induced leaf senescence by suppressing the activation of MAP kinase 6. DOI: 10.1093/jxb/ers122 ; PMID: 22563118
- Phosphorylation of the transcriptional regulator MYB44 by mitogen activated protein kinase regulates Arabidopsis seed germination. DOI: 10.1016/j.bbrc.2012.06.019 ; PMID: 22704933
- MAP Kinase Cascades in Arabidopsis Innate Immunity. DOI: 10.3389/fpls.2012.00169 ; PMID: 22837762
- Rice mitogen-activated protein kinase interactome analysis using the yeast two-hybrid system. DOI: 10.1104/pp.112.200071 ; PMID: 22786887
- Dual-level regulation of ACC synthase activity by MPK3/MPK6 cascade and its downstream WRKY transcription factor during ethylene induction in Arabidopsis. DOI: 10.1371/journal.pgen.1002767 ; PMID: 22761583
- Sorting out the role of nitric oxide in cadmium-induced Arabidopsis thaliana programmed cell death. DOI: 10.4161/psb.21893 ; PMID: 22918505
- MPK11-a fourth elicitor-responsive mitogen-activated protein kinase in Arabidopsis thaliana. DOI: 10.4161/psb.21323 ; PMID: 22899057
- Drought-induced activation and rehydration-induced inactivation of MPK6 in Arabidopsis. DOI: 10.1016/j.bbrc.2012.08.141 ; PMID: 22975351
- Roles of Arabidopsis bax inhibitor-1 in delaying methyl jasmonate-induced leaf senescence. DOI: 10.4161/psb.21776 ; PMID: 22960756
- Phosphorylation and stabilization of Arabidopsis MAP kinase phosphatase 1 in response to UV-B stress. DOI: 10.1074/jbc.M112.434654 ; PMID: 23188831
- Phosphorylation of the zinc finger transcriptional regulator ZAT6 by MPK6 regulates Arabidopsis seed germination under salt and osmotic stress. DOI: 10.1016/j.bbrc.2012.12.039 ; PMID: 23257164
- ATR and MKP1 play distinct roles in response to UV-B stress in Arabidopsis. DOI: 10.1111/tpj.12095 ; PMID: 23237049
- The MPK6-ERF6-ROS-responsive cis-acting Element7/GCC box complex modulates oxidative gene transcription and the oxidative response in Arabidopsis. DOI: 10.1104/pp.112.210724 ; PMID: 23300166
- Brassinosteroid-regulated GSK3/Shaggy-like kinases phosphorylate mitogen-activated protein (MAP) kinase kinases, which control stomata development in Arabidopsis thaliana. DOI: 10.1074/jbc.M112.384453 ; PMID: 23341468
- Acyl-lipid metabolism. DOI: 10.1199/tab.0161 ; PMID: 23505340
- An abscisic acid-independent oxylipin pathway controls stomatal closure and immune defense in Arabidopsis. DOI: 10.1371/journal.pbio.1001513 ; PMID: 23526882
- Phosphorylation of an ERF transcription factor by Arabidopsis MPK3/MPK6 regulates plant defense gene induction and fungal resistance. DOI: 10.1105/tpc.112.109074 ; PMID: 23524660
- Knockout of AtMKK1 enhances salt tolerance and modifies metabolic activities in Arabidopsis. DOI: 10.4161/psb.24206 ; PMID: 23511202
- Pattern-triggered immunity suppresses programmed cell death triggered by fumonisin b1. DOI: 10.1371/journal.pone.0060769 ; PMID: 23560104
- Differential effects of the peptides Stomagen, EPF1 and EPF2 on activation of MAP kinase MPK6 and the SPCH protein level. DOI: 10.1093/pcp/pct076 ; PMID: 23686240
- MPK6 contributes to non-host resistance to magnaporthe oryzae in Arabidopsis thaliana. DOI: 10.1271/bbb.130082 ; PMID: 23748771
- Putrescine regulating by stress-responsive MAPK cascade contributes to bacterial pathogen defense in Arabidopsis. DOI: 10.1016/j.bbrc.2013.06.080 ; PMID: 23831467
- An extracellular subtilase switch for immune priming in Arabidopsis. DOI: 10.1371/journal.ppat.1003445 ; PMID: 23818851
- Repression of growth regulating factors by the microRNA396 inhibits cell proliferation by UV-B radiation in Arabidopsis leaves. DOI: 10.1105/tpc.113.117473 ; PMID: 24076976
- Arabidopsis thaliana mitogen-activated protein kinase 6 is involved in seed formation and modulation of primary and lateral root development. DOI: 10.1093/jxb/ert368 ; PMID: 24218326
- A chemical genetic approach demonstrates that MPK3/MPK6 activation and NADPH oxidase-mediated oxidative burst are two independent signaling events in plant immunity. DOI: 10.1111/tpj.12382 ; PMID: 24245741
- Dual regulation of gene expression mediated by extended MAPK activation and salicylic acid contributes to robust innate immunity in Arabidopsis thaliana. DOI: 10.1371/journal.pgen.1004015 ; PMID: 24348271
- Mitogen-activated protein kinase 6 controls root growth in Arabidopsis by modulating Ca2+ -based Na+ flux in root cell under salt stress. DOI: 10.1016/j.jplph.2013.09.023 ; PMID: 24484955
- The heat shock factor A4A confers salt tolerance and is regulated by oxidative stress and the mitogen-activated protein kinases MPK3 and MPK6. DOI: 10.1104/pp.114.237891 ; PMID: 24676858
- Fast retrograde signaling in response to high light involves metabolite export, MITOGEN-ACTIVATED PROTEIN KINASE6, and AP2/ERF transcription factors in Arabidopsis. DOI: 10.1105/tpc.113.121061 ; PMID: 24668746
- Salt-induced subcellular kinase relocation and seedling susceptibility caused by overexpression of Medicago SIMKK in Arabidopsis. DOI: 10.1093/jxb/eru115 ; PMID: 24648569
- Arabidopsis protein phosphatase 2C ABI1 interacts with type I ACC synthases and is involved in the regulation of ozone-induced ethylene biosynthesis. DOI: 10.1093/mp/ssu025 ; PMID: 24637173
- Alleviation of salt stress by enterobacter sp. EJ01 in tomato and Arabidopsis is accompanied by up-regulation of conserved salinity responsive factors in plants. DOI: 10.14348/molcells.2014.2239 ; PMID: 24598995
- The Arabidopsis thaliana mitogen-activated protein kinases MPK3 and MPK6 target a subclass of 'VQ-motif'-containing proteins to regulate immune responses. DOI: 10.1111/nph.12817 ; PMID: 24750137
- Two Mitogen-Activated Protein Kinases, MPK3 and MPK6, Are Required for Funicular Guidance of Pollen Tubes in Arabidopsis. DOI: 10.1104/pp.113.231274 ; PMID: 24717717
- Activation of MKK9-MPK3/MPK6 enhances phosphate acquisition in Arabidopsis thaliana. DOI: 10.1111/nph.12872 ; PMID: 24865627
- Requirement for pectin methyl esterase and preference for fragmented over native pectins for wall-associated kinase-activated, EDS1/PAD4-dependent stress response in Arabidopsis. DOI: 10.1074/jbc.M114.567545 ; PMID: 24855660
- EDR1 physically interacts with MKK4/MKK5 and negatively regulates a MAP kinase cascade to modulate plant innate immunity. DOI: 10.1371/journal.pgen.1004389 ; PMID: 24830651
- Phosphorylation of a WRKY transcription factor by MAPKs is required for pollen development and function in Arabidopsis. DOI: 10.1371/journal.pgen.1004384 ; PMID: 24830428
- Timing is everything: highly specific and transient expression of a MAP kinase determines auxin-induced leaf venation patterns in Arabidopsis. DOI: 10.1093/mp/ssu080 ; PMID: 25064848
- Arabidopsis LIP5, a positive regulator of multivesicular body biogenesis, is a critical target of pathogen-responsive MAPK cascade in plant basal defense. DOI: 10.1371/journal.ppat.1004243 ; PMID: 25010425
- Functional analysis of Arabidopsis immune-related MAPKs uncovers a role for MPK3 as negative regulator of inducible defences. DOI: 10.1186/gb-2014-15-6-r87 ; PMID: 24980080
- MPK6 controls H2 O2-induced root elongation by mediating Ca2+ influx across the plasma membrane of root cells in Arabidopsis seedlings. DOI: 10.1111/nph.12990 ; PMID: 25145265
- A mitogen-activated protein kinase cascade module, MKK3-MPK6 and MYC2, is involved in blue light-mediated seedling development in Arabidopsis. DOI: 10.1105/tpc.114.128702 ; PMID: 25139007
- Transcriptomic profiling revealed an important role of cell wall remodeling and ethylene signaling pathway during salt acclimation in Arabidopsis. DOI: 10.1007/s11103-014-0230-9 ; PMID: 25092201
- Mitogen-activated protein kinase 6 regulates NPR1 gene expression and activation during leaf senescence induced by salicylic acid. DOI: 10.1093/jxb/eru369 ; PMID: 25210078
- Sclareol induces plant resistance to root-knot nematode partially through ethylene-dependent enhancement of lignin accumulation. DOI: 10.1094/MPMI-10-14-0320-R ; PMID: 25423264
- MicroRNA biogenesis factor DRB1 is a phosphorylation target of mitogen activated protein kinase MPK3 in both rice and Arabidopsis. DOI: 10.1111/febs.13159 ; PMID: 25417716
- Sustained mitogen-activated protein kinase activation reprograms defense metabolism and phosphoprotein profile in Arabidopsis thaliana. DOI: 10.3389/fpls.2014.00554 ; PMID: 25368622
- The Salmonella effector protein SpvC, a phosphothreonine lyase is functional in plant cells. DOI: 10.3389/fmicb.2014.00548 ; PMID: 25368608
- A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. DOI: 10.1371/journal.pone.0116385 ; PMID: 25635681
- The Arabidopsis transcription factor BRASSINOSTEROID INSENSITIVE1-ETHYL METHANESULFONATE-SUPPRESSOR1 is a direct substrate of MITOGEN-ACTIVATED PROTEIN KINASE6 and regulates immunity. DOI: 10.1104/pp.114.250985 ; PMID: 25609555
- MAP kinase phosphatase 1 harbors a novel PTS1 and is targeted to peroxisomes following stress treatments. DOI: 10.1016/j.jplph.2015.03.002 ; PMID: 25817413
- Identification of new members of the MAPK gene family in plants shows diverse conserved domains and novel activation loop variants. DOI: 10.1186/s12864-015-1244-7 ; PMID: 25888265
- Mitogen-Activated Protein Kinase 6 and Ethylene and Auxin Signaling Pathways Are Involved in Arabidopsis Root-System Architecture Alterations by Trichoderma atroviride. DOI: 10.1094/MPMI-01-15-0005-R ; PMID: 26067203
- The Arabidopsis mitogen-activated protein kinase 6 is associated with γ-tubulin on microtubules, phosphorylates EB1c and maintains spindle orientation under nitrosative stress. DOI: 10.1111/nph.13501 ; PMID: 26061286
- NPR1 is Instrumental in Priming for the Enhanced flg22-induced MPK3 and MPK6 Activation. DOI: 10.5423/PPJ.NT.10.2014.0112 ; PMID: 26060439
- Mitogen-activated protein kinase kinase 5 (MKK5)-mediated signalling cascade regulates expression of iron superoxide dismutase gene in Arabidopsis under salinity stress. DOI: 10.1093/jxb/erv305 ; PMID: 26136265
- Multilayered Regulation of Ethylene Induction Plays a Positive Role in Arabidopsis Resistance against Pseudomonas syringae. DOI: 10.1104/pp.15.00659 ; PMID: 26265775
- The state of cell wall pectin monitored by wall associated kinases: A model. DOI: 10.1080/15592324.2015.1035854 ; PMID: 26251881
- A Critical Role of Lyst-Interacting Protein5, a Positive Regulator of Multivesicular Body Biogenesis, in Plant Responses to Heat and Salt Stresses. DOI: 10.1104/pp.15.00518 ; PMID: 26229051
- Endogenous Arabidopsis messenger RNAs transported to distant tissues. DOI: 10.1038/nplants.2015.25 ; PMID: 27247031
- Mitogen-activated protein kinase 6 mediates nuclear translocation of ORE3 to promote ORE9 gene expression in methyl jasmonate-induced leaf senescence. DOI: 10.1093/jxb/erv438 ; PMID: 26507893
- The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis. DOI: 10.3389/fpls.2015.00687 ; PMID: 26442007
- Plant resistance against the parasitic nematode Heterodera schachtii is mediated by MPK3 and MPK6 kinases, which are controlled by the MAPK phosphatase AP2C1 in Arabidopsis. DOI: 10.1093/jxb/erv440 ; PMID: 26438412
- MPK3/MPK6 are involved in iron deficiency-induced ethylene production in Arabidopsis. DOI: 10.3389/fpls.2015.00953 ; PMID: 26579185
- Comparative phospho-proteomics analysis of salt-responsive phosphoproteins regulated by the MKK9-MPK6 cascade in Arabidopsis. DOI: 10.1016/j.plantsci.2015.10.005 ; PMID: 26706066
- Attenuation of pattern recognition receptor signaling is mediated by a MAP kinase kinase kinase. DOI: 10.15252/embr.201540806 ; PMID: 26769563
- The Innate Immune Signaling System as a Regulator of Disease Resistance and Induced Systemic Resistance Activity Against Verticillium dahliae. DOI: 10.1094/MPMI-11-15-0261-R ; PMID: 26780421
- Substrate thiophosphorylation by Arabidopsis mitogen-activated protein kinases. DOI: 10.1186/s12870-016-0731-6 ; PMID: 26912131
- Mitogen-activated protein kinase pathways are required for melatonin-mediated defense responses in plants. DOI: 10.1111/jpi.12314 ; PMID: 26927635
- Quantitative phosphoproteomics of protein kinase SnRK1 regulated protein phosphorylation in Arabidopsis under submergence. DOI: 10.1093/jxb/erw107 ; PMID: 27029354
- Imaging Spatial Reorganization of a MAPK Signaling Pathway Using the Tobacco Transient Expression System. DOI: 10.3791/53790 ; PMID: 27022690
- Pathogen-Responsive MPK3 and MPK6 Reprogram the Biosynthesis of Indole Glucosinolates and Their Derivatives in Arabidopsis Immunity. DOI: 10.1105/tpc.15.00871 ; PMID: 27081184
- Analysis of crystal structure of Arabidopsis MPK6 and generation of its mutants with higher activity. DOI: 10.1038/srep25646 ; PMID: 27160427
- Bacterial AvrRpt2-Like Cysteine Proteases Block Activation of the Arabidopsis Mitogen-Activated Protein Kinases, MPK4 and MPK11. DOI: 10.1104/pp.16.00336 ; PMID: 27208280
- Bacillus cereus AR156 Extracellular Polysaccharides Served as a Novel Micro-associated Molecular Pattern to Induced Systemic Immunity to Pst DC3000 in Arabidopsis. DOI: 10.3389/fmicb.2016.00664 ; PMID: 27242694
- Comparative proteomic study of Arabidopsis mutants mpk4 and mpk6. DOI: 10.1038/srep28306 ; PMID: 27324189
- A double-mutant collection targeting MAP kinase related genes in Arabidopsis for studying genetic interactions. DOI: 10.1111/tpj.13292 ; PMID: 27490954
- Mitogen-Activated Protein Kinase Cascade MKK7-MPK6 Plays Important Roles in Plant Development and Regulates Shoot Branching by Phosphorylating PIN1 in Arabidopsis. DOI: 10.1371/journal.pbio.1002550 ; PMID: 27618482
- Nitric oxide is involved in stomatal development by modulating the expression of stomatal regulator genes in Arabidopsis. DOI: 10.1016/j.plantsci.2016.08.005 ; PMID: 27717464
- Discovery of rice essential genes by characterizing a CRISPR-edited mutation of closely related rice MAP kinase genes. DOI: 10.1111/tpj.13399 ; PMID: 27747971
- Phosphorylation of the Polarity Protein BASL Differentiates Asymmetric Cell Fate through MAPKs and SPCH. DOI: 10.1016/j.cub.2016.08.066 ; PMID: 27746029
- Involvement of YODA and mitogen activated protein kinase 6 in Arabidopsis post-embryogenic root development through auxin up-regulation and cell division plane orientation. DOI: 10.1111/nph.12880 ; PMID: 24923680
- Phytochrome B-mediated activation of lipoxygenase modulates an excess red light-induced defence response in Arabidopsis. DOI: 10.1093/jxb/eru247 ; PMID: 24916071
- Bimolecular fluorescent complementation (BiFC) by MAP kinases and MAPK phosphatases. DOI: 10.1007/978-1-4939-0922-3_12 ; PMID: 24908126
- Immunofluorescent localization of MAPKs and colocalization with microtubules in Arabidopsis seedling whole-mount probes. DOI: 10.1007/978-1-4939-0922-3_9 ; PMID: 24908123
- RNA interference of plant MAPK cascades for functional studies. DOI: 10.1007/978-1-4939-0922-3_8 ; PMID: 24908122
- The Receptor-Like Kinase SIT1 Mediates Salt Sensitivity by Activating MAPK3/6 and Regulating Ethylene Homeostasis in Rice. DOI: 10.1105/tpc.114.125187 ; PMID: 24907341
- Identification of additional MAP kinases activated upon PAMP treatment. DOI: 10.4161/15592324.2014.976155 ; PMID: 25482788
- Ménage à trois: the complex relationships between mitogen-activated protein kinases, WRKY transcription factors, and VQ-motif-containing proteins. DOI: 10.4161/psb.29519 ; PMID: 25763630
- Nucleoporin-Regulated MAP Kinase Signaling in Immunity to a Necrotrophic Fungal Pathogen. DOI: 10.1104/pp.16.00832 ; PMID: 27591188
- Correction: An Extracellular Subtilase Switch for Immune Priming in Arabidopsis. DOI: 10.1371/journal.ppat.1006003 ; PMID: 27806116
- and NO-mediated defense signaling through MAPKKK3 and OXI1 in Arabidopsis thaliana. DOI: 10.1111/jpi.12379 ; PMID: 27862280
- Mitogen-Activated Protein Kinase Phosphatases Affect UV-B-Induced Stomatal Closure via Controlling NO in Guard Cells. DOI: 10.1104/pp.16.01656 ; PMID: 27837091
- Teaching an old dog new tricks: Suppressing activation of specific mitogen-activated kinases as a potential virulence function of the bacterial AvrRpt2 effector protein. DOI: 10.1080/15592324.2016.1257456 ; PMID: 27830985
- AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade. DOI: 10.1104/pp.16.01386 ; PMID: 27913741
- Coronatine Inhibits Stomatal Closure through Guard Cell-Specific Inhibition of NADPH Oxidase-Dependent ROS Production. DOI: 10.3389/fpls.2016.01851 ; PMID: 28018388
- Mild osmotic stress promotes 4-methoxy indolyl-3-methyl glucosinolate biosynthesis mediated by the MKK9-MPK3/MPK6 cascade in Arabidopsis. DOI: 10.1007/s00299-017-2101-8 ; PMID: 28155113
- Phosphorylation of SPOROCYTELESS/NOZZLE by the MPK3/6 Kinase Is Required for Anther Development. DOI: 10.1104/pp.16.01765 ; PMID: 28209842
- Regulation of Stomatal Immunity by Interdependent Functions of a Pathogen-Responsive MPK3/MPK6 Cascade and Abscisic Acid. DOI: 10.1105/tpc.16.00577 ; PMID: 28254778
- Histone H2B monoubiquitination regulates salt stress-induced microtubule depolymerization in Arabidopsis. DOI: 10.1111/pce.12950 ; PMID: 28337773
- Hydrogen sulfide toxicity inhibits primary root growth through the ROS-NO pathway. DOI: 10.1038/s41598-017-01046-2 ; PMID: 28408737
- Abscisic acid signaling is involved in regulating the mitogen-activated protein kinase cascade module, AIK1-MKK5-MPK6. DOI: 10.1080/15592324.2017.1321188 ; PMID: 28494202
- Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. DOI: 10.1093/nar/gkx417 ; PMID: 28510716
- Mitogen-activated protein kinases and calcium-dependent protein kinases are involved in wounding-induced ethylene biosynthesis in Arabidopsis thaliana. DOI: 10.1111/pce.12984 ; PMID: 28543054
- Kinase-Associated Phosphoisoform Assay: a novel candidate-based method to detect specific kinase-substrate phosphorylation interactions in vivo. DOI: 10.1186/s12870-016-0894-1 ; PMID: 27655033
- and jasmonate-inducible MAPK phosphatase and its interception by Arabidopsis immunity. DOI: 10.1073/pnas.1702613114 ; PMID: 28652328
- Role and interrelationship of MEK1-MPK6 cascade, hydrogen peroxide and nitric oxide in darkness-induced stomatal closure. DOI: 10.1016/j.plantsci.2017.06.010 ; PMID: 28716416
- A novel family of proline/serine-rich proteins, which are phospho-targets of stress-related mitogen-activated protein kinases, differentially regulates growth and pathogen defense in Arabidopsis thaliana. DOI: 10.1007/s11103-017-0641-5 ; PMID: 28755319
- Activation of ZmMKK10, a maize mitogen-activated protein kinase kinase, induces ethylene-dependent cell death. DOI: 10.1016/j.plantsci.2017.09.012 ; PMID: 28969793
- MAP65-1 is required for the depolymerization and reorganization of cortical microtubules in the response to salt stress in Arabidopsis. DOI: 10.1016/j.plantsci.2017.09.004 ; PMID: 28969791
- Maternal control of embryogenesis by MPK6 and its upstream MKK4/MKK5 in Arabidopsis. DOI: 10.1111/tpj.13737 ; PMID: 29024034
- Genetic dissection of Arabidopsis MAP kinase phosphatase 1-dependent PAMP-induced transcriptional responses. DOI: 10.1093/jxb/erx335 ; PMID: 29045691
- Phosphorylation of Arabidopsis MAP Kinase Phosphatase 1 (MKP1) Is Required for PAMP Responses and Resistance against Bacteria. DOI: 10.1104/pp.17.01152 ; PMID: 29070514
- and MPK6-Mediated ICE1 Phosphorylation Negatively Regulates ICE1 Stability and Freezing Tolerance in Arabidopsis. DOI: 10.1016/j.devcel.2017.09.025 ; PMID: 29056553
- Quantitative Phosphoproteomic Analysis Reveals Shared and Specific Targets of Arabidopsis Mitogen-Activated Protein Kinases (MAPKs) MPK3, MPK4, and MPK6. DOI: 10.1074/mcp.RA117.000135 ; PMID: 29167316
- Characterization of auxin transporter PIN6 plasma membrane targeting reveals a function for PIN6 in plant bolting. DOI: 10.1111/nph.14923 ; PMID: 29218850
- Arabidopsis MKK10-MPK6 mediates red-light-regulated opening of seedling cotyledons through phosphorylation of PIF3. DOI: 10.1093/jxb/erx418 ; PMID: 29244171
- MAP kinases associate with high molecular weight multiprotein complexes. DOI: 10.1093/jxb/erx424 ; PMID: 29240956
- Combined (15)N-Labeling and TandemMOAC Quantifies Phosphorylation of MAP Kinase Substrates Downstream of MKK7 in Arabidopsis. DOI: 10.3389/fpls.2017.02050 ; PMID: 29276520
- Comparative Analysis of CDPK Family in Maize, Arabidopsis, Rice, and Sorghum Revealed Potential Targets for Drought Tolerance Improvement. DOI: 10.3389/fchem.2017.00115 ; PMID: 29312925
- Mitogen activated protein kinase 6 and MAP kinase phosphatase 1 are involved in the response of Arabidopsis roots to L-glutamate. DOI: 10.1007/s11103-018-0699-8 ; PMID: 29344832
- STRESS INDUCED FACTOR 2, a Leucine-Rich Repeat Kinase Regulates Basal Plant Pathogen Defense. DOI: 10.1104/pp.17.01266 ; PMID: 29463771
- Active photosynthetic inhibition mediated by MPK3/MPK6 is critical to effector-triggered immunity. DOI: 10.1371/journal.pbio.2004122 ; PMID: 29723186
- The Role of MPK6 as Mediator of Ethylene/Jasmonic Acid Signaling in Serendipita indica-Colonized Arabidopsis Roots. DOI: 10.1007/s11105-018-1077-z ; PMID: 29875545
- Receptor-Like Cytoplasmic Kinases Directly Link Diverse Pattern Recognition Receptors to the Activation of Mitogen-Activated Protein Kinase Cascades in Arabidopsis. DOI: 10.1105/tpc.17.00981 ; PMID: 29871986
- PFLP-Intensified Disease Resistance Against Bacterial Soft Rot Through the MAPK Pathway in PAMP-Triggered Immunity. DOI: 10.1094/PHYTO-03-18-0100-R ; PMID: 29975159
- MAP KINASE PHOSPHATASE1 Controls Cell Fate Transition during Stomatal Development. DOI: 10.1104/pp.18.00475 ; PMID: 30002258
- Underground Azelaic Acid-Conferred Resistance to Pseudomonas syringae in Arabidopsis. DOI: 10.1094/MPMI-07-18-0185-R ; PMID: 30156481
- A MPK3/6-WRKY33-ALD1-Pipecolic Acid Regulatory Loop Contributes to Systemic Acquired Resistance. DOI: 10.1105/tpc.18.00547 ; PMID: 30228125
- CLE9 peptide-induced stomatal closure is mediated by abscisic acid, hydrogen peroxide, and nitric oxide in Arabidopsis thaliana. DOI: 10.1111/pce.13475 ; PMID: 30378140
- A Förster resonance energy transfer sensor for live-cell imaging of mitogen-activated protein kinase activity in Arabidopsis. DOI: 10.1111/tpj.14164 ; PMID: 30444549
- Mitogen-activated protein kinases MPK3 and MPK6 are required for stem cell maintenance in the Arabidopsis shoot apical meristem. DOI: 10.1007/s00299-018-2367-5 ; PMID: 30552452
- Regulation of GDSL Lipase Gene Expression by the MPK3/MPK6 Cascade and Its Downstream WRKY Transcription Factors in Arabidopsis Immunity. DOI: 10.1094/MPMI-06-18-0171-R ; PMID: 30598046
- Regulation of pollen lipid body biogenesis by MAP kinases and downstream WRKY transcription factors in Arabidopsis. DOI: 10.1371/journal.pgen.1007880 ; PMID: 30586356
- Chemical genetic identification of a lectin receptor kinase that transduces immune responses and interferes with abscisic acid signaling. DOI: 10.1111/tpj.14232 ; PMID: 30659683
- INDETERMINATE-DOMAIN 4 (IDD4) coordinates immune responses with plant-growth in Arabidopsis thaliana. DOI: 10.1371/journal.ppat.1007499 ; PMID: 30677094
- Multicolour three dimensional structured illumination microscopy of immunolabeled plant microtubules and associated proteins. DOI: 10.1186/s13007-019-0406-z ; PMID: 30899319
- The MKK7-MPK6 MAP Kinase Module Is a Regulator of Meristem Quiescence or Active Growth in Arabidopsis. DOI: 10.3389/fpls.2019.00202 ; PMID: 30891050
- A stress-response-related inter-compartmental signalling pathway regulates embryonic cuticle integrity in Arabidopsis. DOI: 10.1371/journal.pgen.1007847 ; PMID: 30998684
- MKP1 acts as a key modulator of stomatal development. DOI: 10.1080/15592324.2019.1604017 ; PMID: 30983545
- Mitogen-activated protein kinase 6 integrates phosphate and iron responses for indeterminate root growth in Arabidopsis thaliana. DOI: 10.1007/s00425-019-03212-4 ; PMID: 31190117
- A chloroplast-localized mitochondrial calcium uniporter transduces osmotic stress in Arabidopsis. DOI: 10.1038/s41477-019-0434-8 ; PMID: 31182842
- A PAMP-triggered MAPK cascade inhibits phosphatidylinositol 4,5-bisphosphate production by PIP5K6 in Arabidopsis thaliana. DOI: 10.1111/nph.16069 ; PMID: 31318449
- Phosphatidic acid promotes the activation and plasma membrane localization of MKK7 and MKK9 in response to salt stress. DOI: 10.1016/j.plantsci.2019.110190 ; PMID: 31481213
- Function of miR825 and miR825* as Negative Regulators in Bacillus cereus AR156-elicited Systemic Resistance to Botrytis cinerea in Arabidopsis thaliana. DOI: 10.3390/ijms20205032 ; PMID: 31614458
- H2Bub1 Regulates RbohD-Dependent Hydrogen Peroxide Signal Pathway in the Defense Responses to Verticillium dahliae Toxins. DOI: 10.1104/pp.19.00913 ; PMID: 31666300
- Involvement of the eIF2α Kinase GCN2 in UV-B Responses. DOI: 10.3389/fpls.2019.01492 ; PMID: 31850012
- MAPK Signaling: Emerging Roles in Lateral Root Formation. DOI: 10.1016/j.tplants.2019.11.006 ; PMID: 31848035
- Arabidopsis MAPKKK δ-1 is required for full immunity against bacterial and fungal infection. DOI: 10.1093/jxb/erz556 ; PMID: 31844896
- YODA-HSP90 Module Regulates Phosphorylation-Dependent Inactivation of SPEECHLESS to Control Stomatal Development under Acute Heat Stress in Arabidopsis. DOI: 10.1016/j.molp.2020.01.001 ; PMID: 31935463
- Biological impacts of phosphomimic AtMYB75. DOI: 10.1007/s00425-020-03350-0 ; PMID: 32030477
- Involvement of active MKK9-MAPK3/MAPK6 in increasing respiration in salt-treated Arabidopsis callus. DOI: 10.1007/s00709-020-01483-3 ; PMID: 32008084
- Phosphorylation-dependent control of an RNA granule-localized protein that fine-tunes defence gene expression at a post-transcriptional level. DOI: 10.1111/tpj.14573 ; PMID: 31628867
- Pathogen-Associated Molecular Pattern-Triggered Immunity Involves Proteolytic Degradation of Core Nonsense-Mediated mRNA Decay Factors During the Early Defense Response. DOI: 10.1105/tpc.19.00631 ; PMID: 32086363
- The BIR2/BIR3-Associated Phospholipase Dγ1 Negatively Regulates Plant Immunity. DOI: 10.1104/pp.19.01292 ; PMID: 32152212
- The MAPK substrate MASS proteins regulate stomatal development in Arabidopsis. DOI: 10.1371/journal.pgen.1008706 ; PMID: 32240168
- Wounding and Insect Feeding Trigger Two Independent MAPK Pathways with Distinct Regulation and Kinetics. DOI: 10.1105/tpc.19.00917 ; PMID: 32265268
- Role of MPK4 in pathogen-associated molecular pattern-triggered alternative splicing in Arabidopsis. DOI: 10.1371/journal.ppat.1008401 ; PMID: 32302366
- Differential Phosphorylation of the Transcription Factor WRKY33 by the Protein Kinases CPK5/CPK6 and MPK3/MPK6 Cooperatively Regulates Camalexin Biosynthesis in Arabidopsis. DOI: 10.1105/tpc.19.00971 ; PMID: 32439826
- Induction of γ-aminobutyric acid plays a positive role to Arabidopsis resistance against Pseudomonas syringae. DOI: 10.1111/jipb.12974 ; PMID: 32458527
- Co-regulation of indole glucosinolates and camalexin biosynthesis by CPK5/CPK6 and MPK3/MPK6 signaling pathways. DOI: 10.1111/jipb.12973 ; PMID: 32449805
- A Kinase-Phosphatase-Transcription Factor Module Regulates Adventitious Root Emergence in Arabidopsis Root-Hypocotyl Junctions. DOI: 10.1016/j.molp.2020.06.002 ; PMID: 32534220
- Arabidopsis CPK5 Phosphorylates the Chitin Receptor LYK5 to Regulate Plant Innate Immunity. DOI: 10.3389/fpls.2020.00702 ; PMID: 32595659
- The Arabidopsis Pleiotropic Drug Resistance Transporters PEN3 and PDR12 Mediate Camalexin Secretion for Resistance to Botrytis cinerea. DOI: 10.1105/tpc.19.00239 ; PMID: 31239392
- Secreted Peptide PIP1 Induces Stomatal Closure by Activation of Guard Cell Anion Channels in Arabidopsis. DOI: 10.3389/fpls.2020.01029 ; PMID: 32733520
- Phosphorylation of the CAMTA3 Transcription Factor Triggers Its Destabilization and Nuclear Export. DOI: 10.1104/pp.20.00795 ; PMID: 32769161
- Global Quantitative Proteomics Studies Revealed Tissue-Preferential Expression and Phosphorylation of Regulatory Proteins in Arabidopsis. DOI: 10.3390/ijms21176116 ; PMID: 32854314
- Arabidopsis E3 ligase KEG associates with and ubiquitinates MKK4 and MKK5 to regulate plant immunity. DOI: 10.1111/jipb.13007 ; PMID: 32877006
- The YDA-MKK4/MKK5-MPK3/MPK6 Cascade Functions Downstream of the RGF1-RGI Ligand-Receptor Pair in Regulating Mitotic Activity in Root Apical Meristem. DOI: 10.1016/j.molp.2020.09.004 ; PMID: 32916336
- RGF1-RGI1, a Peptide-Receptor Complex, Regulates Arabidopsis Root Meristem Development via a MAPK Signaling Cascade. DOI: 10.1016/j.molp.2020.09.005 ; PMID: 32916335
- AtMPK6-induced phosphorylation of AtERF72 enhances its DNA binding activity and interaction with TGA4/OBF4 in Arabidopsis. DOI: 10.1111/plb.13196 ; PMID: 33073469
- The growth of Arabidopsis primary root is repressed by several and diverse amino acids through auxin-dependent and independent mechanisms and MPK6 kinase activity. DOI: 10.1016/j.plantsci.2020.110717 ; PMID: 33288023
- Kinases and protein motifs required for AZI1 plastid localization and trafficking during plant defense induction. DOI: 10.1111/tpj.15137 ; PMID: 33342031
- Chromatin phosphoproteomics unravels a function for AT-hook motif nuclear localized protein AHL13 in PAMP-triggered immunity. DOI: 10.1073/pnas.2004670118 ; PMID: 33419940
- AtPFA-DSP3, an atypical dual-specificity protein tyrosine phosphatase, affects salt stress response by modulating MPK3 and MPK6 activity. DOI: 10.1111/pce.14002 ; PMID: 33464564
- Ethylene-induced stomatal closure is mediated via MKK1/3-MPK3/6 cascade to EIN2 and EIN3. DOI: 10.1111/jipb.13083 ; PMID: 33605510
- SUMO enables substrate selectivity by mitogen-activated protein kinases to regulate immunity in plants. DOI: 10.1073/pnas.2021351118 ; PMID: 33649235
- A C-terminal fragment of Arabidopsis OXIDATIVE STRESS 2 can play a positive role in salt tolerance. DOI: 10.1016/j.bbrc.2021.03.127 ; PMID: 33836344
- Mitogen-activated protein kinase 6 negatively regulates secondary wall biosynthesis by modulating MYB46 protein stability in Arabidopsis thaliana. DOI: 10.1371/journal.pgen.1009510 ; PMID: 33826618
- Cross Inhibition of MPK10 and WRKY10 Participating in the Growth of Endosperm in Arabidopsis thaliana. DOI: 10.3389/fpls.2021.640346 ; PMID: 33897728
- A dual-specificity phosphatase, MAP kinase phosphatase 1, positively regulates blue light-mediated seedling development in Arabidopsis. DOI: 10.1007/s00425-021-03649-6 ; PMID: 34057637
- Modulation of polyamine metabolism in Arabidopsis thaliana by salicylic acid. DOI: 10.1111/ppl.13478 ; PMID: 34109645
- Naringenin Induces Pathogen Resistance Against Pseudomonas syringae Through the Activation of NPR1 in Arabidopsis. DOI: 10.3389/fpls.2021.672552 ; PMID: 34093630
- MPK6 Kinase Regulates Plasma Membrane H(+)-ATPase Activity in Cold Acclimation. DOI: 10.3390/ijms22126338 ; PMID: 34199294
- Multiple phosphorylation events of the mitochondrial membrane protein TTM1 regulate cell death during senescence. DOI: 10.1111/tpj.15470 ; PMID: 34409658
- MPK3/6-induced degradation of ARR1/10/12 promotes salt tolerance in Arabidopsis. DOI: 10.15252/embr.202152457 ; PMID: 34402578
- A New Approach for Wounding Research: MYC2 Gene Expression and Protein Stability in Wounded Arabidopsis Protoplasts. DOI: 10.3390/plants10081518 ; PMID: 34451563
- MPK3/MPK6-mediated phosphorylation of ERF72 positively regulates resistance to Botrytis cinerea through directly and indirectly activating the transcription of camalexin biosynthesis enzymes. DOI: 10.1093/jxb/erab415 ; PMID: 34499162
- The kinase CIPK14 functions as a negative regulator of plant immune responses to Pseudomonas syringae in Arabidopsis. DOI: 10.1016/j.plantsci.2021.111017 ; PMID: 34620426
- Lectin receptor-like kinase LecRK-VIII.2 is a missing link in MAPK signaling-mediated yield control. DOI: 10.1093/plphys/kiab241 ; PMID: 34618128
- MKK4/5-MPK3/6 Cascade Regulates Agrobacterium-Mediated Transformation by Modulating Plant Immunity in Arabidopsis. DOI: 10.3389/fpls.2021.731690 ; PMID: 34659297
- Inhibition of Arabidopsis stomatal development by plastoquinone oxidation. DOI: 10.1016/j.cub.2021.10.018 ; PMID: 34727522
- and MPK6-mediated VLN3 phosphorylation regulates actin dynamics during stomatal immunity in Arabidopsis. DOI: 10.1038/s41467-021-26827-2 ; PMID: 34753953
- and MPK6-mediated hypoxia signaling in Arabidopsis. DOI: 10.1093/plcell/koab289 ; PMID: 34850198
- AtPFA-DSP5 interacts with MPK3/MPK6 and negatively regulates plant salt responses. DOI: 10.1080/15592324.2021.2000808 ; PMID: 34839796
- Two phylogenetically unrelated peptide-receptor modules jointly regulate lateral root initiation via a partially shared signaling pathway in Arabidopsis thaliana. DOI: 10.1111/nph.17919 ; PMID: 34913488
- MPK3 and MPK6 control salicylic acid signaling by up-regulating NLR receptors and effector-triggered immunity. DOI: 10.1093/jxb/erab544 ; PMID: 35032388
- Dual control of MAPK activities by AP2C1 and MKP1 MAPK phosphatases regulates defence responses in Arabidopsis. DOI: 10.1093/jxb/erac018 ; PMID: 35088853
- S-Nitrosation of Arabidopsis thaliana Protein Tyrosine Phosphatase 1 Prevents Its Irreversible Oxidation by Hydrogen Peroxide. DOI: 10.3389/fpls.2022.807249 ; PMID: 35222471
- Regulation of Arabidopsis Matrix Metalloproteinases by Mitogen-Activated Protein Kinases and Their Function in Leaf Senescence. DOI: 10.3389/fpls.2022.864986 ; PMID: 35463412
- Dichotomy of the BSL phosphatase signaling spatially regulates MAPK components in stomatal fate determination. DOI: 10.1038/s41467-022-30254-2 ; PMID: 35508457
- Phytocytokine signalling reopens stomata in plant immunity and water loss. DOI: 10.1038/s41586-022-04684-3 ; PMID: 35508659
- Phosphorylation of an ethylene response factor by MPK3/MPK6 mediates negative feedback regulation of pathogen-induced ethylene biosynthesis in Arabidopsis. DOI: 10.1016/j.jgg.2022.04.012 ; PMID: 35562093
- Multilayered synergistic regulation of phytoalexin biosynthesis by ethylene, jasmonate, and MAPK signaling pathways in Arabidopsis. DOI: 10.1093/plcell/koac139 ; PMID: 35543483
- Overlapping functions of YDA and MAPKKK3/MAPKKK5 upstream of MPK3/MPK6 in plant immunity and growth/development. DOI: 10.1111/jipb.13309 ; PMID: 35652263
- Bacterial cyclodipeptides elicit Arabidopsis thaliana immune responses reducing the pathogenic effects of Pseudomonas aeruginosa PAO1 strains on plant development. DOI: 10.1016/j.jplph.2022.153738 ; PMID: 35690030
- CYSTEINE-RICH RECEPTOR-LIKE KINASE5 (CRK5) and CRK22 regulate the response to Verticillium dahliae toxins. DOI: 10.1093/plphys/kiac277 ; PMID: 35674361
- Bacillus amyloliquefaciens PMB05 Increases Resistance to Bacterial Wilt by Activating Mitogen-Activated Protein Kinase and Reactive Oxygen Species Pathway Crosstalk in Arabidopsis thaliana. DOI: 10.1094/PHYTO-04-22-0134-R ; PMID: 35793151
- Mucilaginibacter sp. K Improves Growth and Induces Salt Tolerance in Nonhost Plants via Multilevel Mechanisms. DOI: 10.3389/fpls.2022.938697 ; PMID: 35832221
- Crystal structure of the phosphorylated Arabidopsis MKK5 reveals activation mechanism of MAPK kinases. DOI: 10.3724/abbs.2022089 ; PMID: 35866601
- Phosphorylation of the auxin signaling transcriptional repressor IAA15 by MPKs is required for the suppression of root development under drought stress in Arabidopsis. DOI: 10.1093/nar/gkac798 ; PMID: 36161329
- Arabidopsis MPK3 and MPK6 regulates D-glucose signaling and interacts with G-protein, RGS1. DOI: 10.1016/j.plantsci.2022.111484 ; PMID: 36195119
- Cellular messengers involved in the inhibition of the Arabidopsis primary root growth by bacterial quorum-sensing signal N-decanoyl-L-homoserine lactone. DOI: 10.1186/s12870-022-03865-6 ; PMID: 36229795
- BPL3 binds the long non-coding RNA nalncFL7 to suppress FORKED-LIKE7 and modulate HAI1-mediated MPK3/6 dephosphorylation in plant immunity. DOI: 10.1093/plcell/koac311 ; PMID: 36269178
- Arabidopsis EXTRA-LARGE G PROTEIN 1 (XLG1) functions together with XLG2 and XLG3 in PAMP-triggered MAPK activation and immunity. DOI: 10.1111/jipb.13391 ; PMID: 36250681
- ROOT MERISTEM GROWTH FACTOR1 (RGF1)-RGF1 INSENSITIVE 1 peptide-receptor pair inhibits lateral root development via the MPK6-PUCHI module in Arabidopsis. DOI: 10.1093/jxb/erac495 ; PMID: 36516421
- RAV1 family members function as transcriptional regulators and play a positive role in plant disease resistance. DOI: 10.1111/tpj.16114 ; PMID: 36703574
- Phosphorylation of the LCB1 subunit of Arabidopsis serine palmitoyltransferase stimulates its activity and modulates sphingolipid biosynthesis. DOI: 10.1111/jipb.13461 ; PMID: 36738228
- An EPFL peptide signaling pathway promotes stamen elongation via enhancing filament cell proliferation to ensure successful self-pollination in Arabidopsis thaliana. DOI: 10.1111/nph.18806 ; PMID: 36772858
- Sphingolipid Long-Chain Base Signaling in Compatible and Non-Compatible Plant-Pathogen Interactions in Arabidopsis. DOI: 10.3390/ijms24054384 ; PMID: 36901815
- Suppression of ETI by PTI priming to balance plant growth and defense through an MPK3/MPK6-WRKYs-PP2Cs module. DOI: 10.1016/j.molp.2023.04.004 ; PMID: 37041748
- A prospective study of short-term apoplastic responses to ammonium treatment. DOI: 10.1016/j.jplph.2023.154008 ; PMID: 37245458
- Cell type-specific proteomics uncovers a RAF15-SnRK2.6/OST1 kinase cascade in guard cells. DOI: 10.1111/jipb.13536 ; PMID: 37226855
- MYB44 regulates PTI by promoting the expression of EIN2 and MPK3/6 in Arabidopsis. DOI: 10.1016/j.xplc.2023.100628 ; PMID: 37221824
- Mitogen-activated protein kinase cascades in plants: a new nomenclature. DOI: 10.1016/s1360-1385(02)02302-6 ; PMID: 12119167
- Ancient signals: comparative genomics of plant MAPK and MAPKK gene families. DOI: 10.1016/j.tplants.2006.02.007 ; PMID: 16537113
- Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis. DOI: 10.1105/tpc.106.048298 ; PMID: 17259259
- Comparative Analysis of CDPK Family in Maize, Arabidopsis, Rice, and Sorghum Revealed Potential Targets for Drought Tolerance Improvement. DOI: 10.3389/fchem.2017.00115 ; PMID: 29312925
Gene Resources
- UniProt: A0A178VTX8
- EMBL: CACRSJ010000105, CACSHJ010000088, LR881467
- AlphaFoldDB: A0A178VTX8
- EnsemblPlants: AT2G43790.1
- Gramene: AT2G43790.1
- KEGG: ath:AT2G43790
- Orthologous matrix: CYFLYQM
- ExpressionAtlas: AT2G43790
- InterPro: IPR000719, IPR003527, IPR008271
- PANTHER: PTHR24055
- SUPFAM: SSF56112
- PROSITE: PS00107, PS00108, PS01351
- Gene3D: 1.10.510.10, 3.30.200.20
- OrthoDB: A0A178VTX8
- SWISS-MODEL: A0A178VTX8
- Conserved Domain Database: cd07858
Sequences
cDNA Sequence
- >AT2G43790.1
TGAAGACCCAAAAAAAAATAAAAAAATTAATAGATCCGTACGCACATGACTTTCACTTCTTGTCTCTCAGATCTGTTTTGACCCCAAAACCAACGAATATCAATTTCTCCAATTTCATTCATAATTCACTCACCCCAAAATTACAAAAAAAAAAAAAAAAAAAGATTTTCCATTTCCCTCTTCTCGATCCACCACCACCACCAACCTCAAAAGCTTTCATCTTTACCGGTCATGGACGGTGGTTCAGGTCAACCGGCGGCTGATACAGAGATGACAGAAGCTCCTGGAGGTTTTCCCGCGGCGGCTCCATCGCCTCAGATGCCTGGGATTGAGAATATTCCGGCGACTCTTAGCCATGGTGGTAGGTTTATTCAGTATAACATATTTGGAAACATCTTCGAGGTCACCGCTAAGTATAAGCCTCCGATCATGCCTATTGGCAAGGGTGCTTATGGCATCGTTTGTTCGGCTATGAATTCTGAAACTAACGAGAGCGTTGCGATTAAGAAAATTGCTAACGCTTTTGACAATAAGATTGATGCTAAGAGGACTCTCCGTGAGATCAAGCTGCTTCGTCACATGGATCATGAAAATATTGTTGCAATCAGAGATATTATCCCGCCACCATTAAGAAACGCTTTCAACGATGTTTACATCGCGTATGAGTTAATGGACACTGATCTCCATCAAATCATTCGGTCAAATCAAGCATTATCCGAAGAACATTGCCAGTATTTTCTTTACCAGATCCTCCGTGGATTGAAATACATTCACTCTGCAAATGTGCTTCACAGGGATTTGAAACCAAGTAATCTCCTCCTGAACGCAAACTGCGACCTAAAAATCTGCGATTTTGGGCTAGCTCGAGTCACTTCTGAGAGTGATTTCATGACTGAATATGTTGTCACGAGATGGTACCGTGCACCAGAGCTTCTCTTAAACTCTTCTGATTATACTGCAGCTATCGATGTTTGGTCTGTAGGCTGTATTTTCATGGAGTTAATGGACCGTAAGCCACTCTTCCCTGGACGAGATCATGTCCATCAGCTTCGCTTGCTCATGGAGCTCATAGGAACTCCATCAGAAGAAGAGCTCGAGTTCTTGAACGAAAACGCAAAGCGATACATAAGACAGCTTCCACCTTATCCTCGCCAATCCATCACTGATAAGTTCCCGACAGTGCATCCTTTAGCTATAGACCTTATCGAGAAGATGTTAACATTTGATCCTAGACGGAGAATCACAGTTTTAGACGCATTGGCCCATCCATACCTGAACTCGTTGCACGACATAAGCGATGAGCCAGAGTGTACAATACCTTTCAACTTTGATTTTGAAAACCATGCACTCTCAGAGGAGCAGATGAAGGAACTAATCTACCGCGAGGCGCTTGCTTTCAATCCAGAATATCAGCAATAGTTTGAAGAACAGCATTTGGGAGATGAAGATGAGATAAGGGTTTGGCGTTATTTGGTTTGGACAACATTCTTAAAAGGAGGAAAGATCATTGTTTGTCTTTTGTGTATACTTGTGAGAGATGTTGAAGGGGATGGGTCTCAAACTTTATATTTCAGTCTTTTGGATAATTTGTTCTCTCTGTTTTTTTTTTTCCTATTCGTATTTGTAATTTGCCCTCATTTTGTTGTTGCAGTTATTTAAGACTTAAATTGTCTCAGAAATAGTTATGTTATGATAGCCCACCTTCAATTCCTCT
CDS Sequence
- >AT2G43790.1
ATGGACGGTGGTTCAGGTCAACCGGCGGCTGATACAGAGATGACAGAAGCTCCTGGAGGTTTTCCCGCGGCGGCTCCATCGCCTCAGATGCCTGGGATTGAGAATATTCCGGCGACTCTTAGCCATGGTGGTAGGTTTATTCAGTATAACATATTTGGAAACATCTTCGAGGTCACCGCTAAGTATAAGCCTCCGATCATGCCTATTGGCAAGGGTGCTTATGGCATCGTTTGTTCGGCTATGAATTCTGAAACTAACGAGAGCGTTGCGATTAAGAAAATTGCTAACGCTTTTGACAATAAGATTGATGCTAAGAGGACTCTCCGTGAGATCAAGCTGCTTCGTCACATGGATCATGAAAATATTGTTGCAATCAGAGATATTATCCCGCCACCATTAAGAAACGCTTTCAACGATGTTTACATCGCGTATGAGTTAATGGACACTGATCTCCATCAAATCATTCGGTCAAATCAAGCATTATCCGAAGAACATTGCCAGTATTTTCTTTACCAGATCCTCCGTGGATTGAAATACATTCACTCTGCAAATGTGCTTCACAGGGATTTGAAACCAAGTAATCTCCTCCTGAACGCAAACTGCGACCTAAAAATCTGCGATTTTGGGCTAGCTCGAGTCACTTCTGAGAGTGATTTCATGACTGAATATGTTGTCACGAGATGGTACCGTGCACCAGAGCTTCTCTTAAACTCTTCTGATTATACTGCAGCTATCGATGTTTGGTCTGTAGGCTGTATTTTCATGGAGTTAATGGACCGTAAGCCACTCTTCCCTGGACGAGATCATGTCCATCAGCTTCGCTTGCTCATGGAGCTCATAGGAACTCCATCAGAAGAAGAGCTCGAGTTCTTGAACGAAAACGCAAAGCGATACATAAGACAGCTTCCACCTTATCCTCGCCAATCCATCACTGATAAGTTCCCGACAGTGCATCCTTTAGCTATAGACCTTATCGAGAAGATGTTAACATTTGATCCTAGACGGAGAATCACAGTTTTAGACGCATTGGCCCATCCATACCTGAACTCGTTGCACGACATAAGCGATGAGCCAGAGTGTACAATACCTTTCAACTTTGATTTTGAAAACCATGCACTCTCAGAGGAGCAGATGAAGGAACTAATCTACCGCGAGGCGCTTGCTTTCAATCCAGAATATCAGCAATAG
Protein Sequence
- >AT2G43790.1
MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ