Information report for AT2G42530
Gene Details
|
|
Functional Descriptions
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- GO:0009737 — involved in — response to abscisic acid
- GO:0050832 — acts upstream of or within — defense response to fungus
- GO:0009631 — acts upstream of or within — cold acclimation
- GO:0005534 — enables — galactose binding
- GO:0009507 — located in — chloroplast
- GO:0009570 — located in — chloroplast stroma
- GO:0008289 — enables — lipid binding
- GO:0009941 — located in — chloroplast envelope
- GO:0010150 — acts upstream of or within — leaf senescence
- GO:0009409 — involved in — response to cold
- GO:0005829 — located in — cytosol
Functional Keywords
Literature and News
- Genome-wide gene expression profiling in Arabidopsis thaliana reveals new targets of abscisic acid and largely impaired gene regulation in the abi1-1 mutant. DOI: 10.1242/jcs.00175 ; PMID: 12432076
- Transcriptome changes for Arabidopsis in response to salt, osmotic, and cold stress. DOI: 10.1104/pp.008532 ; PMID: 12481097
- Gene expression analyses of Arabidopsis chromosome 2 using a genomic DNA amplicon microarray. DOI: 10.1101/gr.552003 ; PMID: 12618363
- OsDREB genes in rice, Oryza sativa L., encode transcription activators that and cold-responsive gene expression. DOI: 10.1046/j.1365-313x.2003.01661.x ; PMID: 12609047
- Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. DOI: 10.1074/jbc.M308435200 ; PMID: 14576160
- ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis. DOI: 10.1111/j.1365-313X.2004.02055.x ; PMID: 15086800
- Identification of cold-inducible downstream genes of the Arabidopsis DREB1A/CBF3 transcriptional factor using two microarray systems. DOI: 10.1111/j.1365-313X.2004.02100.x ; PMID: 15165189
- Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. DOI: 10.1111/j.1365-313X.2004.02176.x ; PMID: 15341633
- The stability of the Arabidopsis transcriptome in transgenic plants expressing the marker genes nptII and uidA. DOI: 10.1111/j.1365-313X.2005.02350.x ; PMID: 15743445
- Expression profiling reveals COI1 to be a key regulator of genes involved in and methyl jasmonate-induced secondary metabolism, defence, and hormone interactions. DOI: 10.1007/s11103-005-7306-5 ; PMID: 16021335
- A global survey of gene regulation during cold acclimation in Arabidopsis thaliana. DOI: 10.1371/journal.pgen.0010026 ; PMID: 16121258
- The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions. DOI: 10.1104/pp.105.068171 ; PMID: 16258011
- Transcriptional profiling implicates novel interactions between abiotic stress and hormonal responses in Thellungiella, a close relative of Arabidopsis. DOI: 10.1104/pp.105.070508 ; PMID: 16500996
- Monitoring expression profiles of Arabidopsis genes during cold acclimation and deacclimation using DNA microarrays. DOI: 10.1007/s10142-005-0014-z ; PMID: 16463051
- The Arabidopsis co-expression tool (ACT): a WWW-based tool and database for microarray-based gene expression analysis. DOI: 10.1111/j.1365-313X.2006.02681.x ; PMID: 16623895
- Functional analysis of an Arabidopsis transcription factor, DREB2A, involved in drought-responsive gene expression. DOI: 10.1105/tpc.105.035881 ; PMID: 16617101
- Exploiting the wild crucifer Thlaspi arvense to identify conserved and novel genes expressed during a plant's response to cold stress. DOI: 10.1007/s11103-006-9080-4 ; PMID: 16972165
- Genetic variation suggests interaction between cold acclimation and metabolic regulation of leaf senescence. DOI: 10.1104/pp.106.091355 ; PMID: 17098848
- AthaMap web tools for the analysis and identification of co-regulated genes. DOI: 10.1093/nar/gkl1006 ; PMID: 17148485
- Arabidopsis ESK1 encodes a novel regulator of freezing tolerance. DOI: 10.1111/j.1365-313X.2006.02994.x ; PMID: 17316173
- Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. DOI: 10.1104/pp.107.098293 ; PMID: 17478635
- Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis. DOI: 10.1104/pp.107.110981 ; PMID: 18162593
- Comparative transcriptome of diurnally oscillating genes and hormone-responsive genes in Arabidopsis thaliana: insight into circadian clock-controlled daily responses to common ambient stresses in plants. DOI: 10.1093/pcp/pcn008 ; PMID: 18202002
- LEA (late embryogenesis abundant) proteins and their encoding genes in Arabidopsis thaliana. DOI: 10.1186/1471-2164-9-118 ; PMID: 18318901
- The plant Apolipoprotein D ortholog protects Arabidopsis against oxidative stress. DOI: 10.1186/1471-2229-8-86 ; PMID: 18671872
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- The DDF1 transcriptional activator upregulates expression of a gibberellin-deactivating gene, GA2ox7, under high-salinity stress in Arabidopsis. DOI: 10.1111/j.1365-313X.2008.03627.x ; PMID: 18643985
- The Arabidopsis NFYA5 transcription factor is regulated transcriptionally and posttranscriptionally to promote drought resistance. DOI: 10.1105/tpc.108.059444 ; PMID: 18682547
- Differential SAGE analysis in Arabidopsis uncovers increased transcriptome complexity in response to low temperature. DOI: 10.1186/1471-2164-9-434 ; PMID: 18808718
- Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. DOI: 10.1104/pp.108.126979 ; PMID: 18805951
- Disease-specific expression of host genes during downy mildew infection of Arabidopsis. DOI: 10.1094/MPMI-22-9-1104 ; PMID: 19656045
- Overproduction of the membrane-bound receptor-like protein kinase 1, RPK1, enhances abiotic stress tolerance in Arabidopsis. DOI: 10.1074/jbc.M109.051938 ; PMID: 20089852
- Interaction of two intrinsically disordered plant stress proteins (COR15A and COR15B) with lipid membranes in the dry state. DOI: 10.1016/j.bbamem.2010.05.015 ; PMID: 20510170
- A nuclear-localized protein, KOLD SENSITIV-1, affects the expression of cold-responsive genes during prolonged chilling in Arabidopsis. DOI: 10.1016/j.jplph.2010.07.001 ; PMID: 20674078
- The Arabidopsis NAC transcription factor VNI2 integrates abscisic acid signals into leaf senescence via the COR/RD genes. DOI: 10.1105/tpc.111.084913 ; PMID: 21673078
- Functional characterization of an abiotic stress-inducible transcription factor AtERF53 in Arabidopsis thaliana. DOI: 10.1007/s11103-013-0054-z ; PMID: 23625358
- Strength comparison between cold-inducible promoters of Arabidopsis cor15a and cor15b genes in potato and tobacco. DOI: 10.1016/j.plaphy.2013.06.021 ; PMID: 23886924
- The ubiquitous distribution of late embryogenesis abundant proteins across cell compartments in Arabidopsis offers tailored protection against abiotic stress. DOI: 10.1105/tpc.114.127316 ; PMID: 25005920
- Disordered cold regulated15 proteins protect chloroplast membranes during freezing through binding and folding, but do not stabilize chloroplast enzymes in vivo. DOI: 10.1104/pp.114.245399 ; PMID: 25096979
- A mechanistic model of COR15 protein function in plant freezing tolerance: integration of structural and functional characteristics. DOI: 10.4161/15592324.2014.977722 ; PMID: 25496049
- Overexpression of a NF-YB3 transcription factor from Picea wilsonii confers tolerance to salinity and drought stress in transformed Arabidopsis thaliana. DOI: 10.1016/j.plaphy.2015.05.001 ; PMID: 26093308
- Molecular dynamics simulations and CD spectroscopy reveal hydration-induced unfolding of the intrinsically disordered LEA proteins COR15A and COR15B from Arabidopsis thaliana. DOI: 10.1039/c6cp02272c ; PMID: 27255148
- Folding of intrinsically disordered plant LEA proteins is driven by glycerol-induced crowding and the presence of membranes. DOI: 10.1111/febs.14023 ; PMID: 28109185
- Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. DOI: 10.1105/tpc.16.00669 ; PMID: 28351986
- Hydrogen sulfide alleviates the cold stress through MPK4 in Arabidopsis thaliana. DOI: 10.1016/j.plaphy.2017.09.028 ; PMID: 29024849
- Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. DOI: 10.1186/s12870-018-1255-z ; PMID: 29490615
- AtCaM4 interacts with a Sec14-like protein, PATL1, to regulate freezing tolerance in Arabidopsis in a CBF-independent manner. DOI: 10.1093/jxb/ery278 ; PMID: 30124909
- Folding and Lipid Composition Determine Membrane Interaction of the Disordered Protein COR15A. DOI: 10.1016/j.bpj.2018.08.014 ; PMID: 30195939
- GmWRKY16 Enhances Drought and Salt Tolerance Through an ABA-Mediated Pathway in Arabidopsis thaliana. DOI: 10.3389/fpls.2018.01979 ; PMID: 30740122
- BYPASS1-LIKE, A DUF793 Family Protein, Participates in Freezing Tolerance via the CBF Pathway in Arabidopsis. DOI: 10.3389/fpls.2019.00807 ; PMID: 31297122
- A Role for PICKLE in the Regulation of Cold and Salt Stress Tolerance in Arabidopsis. DOI: 10.3389/fpls.2019.00900 ; PMID: 31354770
- Proteomic study of the Arabidopsis thaliana chloroplastic envelope membrane utilizing alternatives to traditional two-dimensional electrophoresis. DOI: 10.1021/pr034025j ; PMID: 12938931
- Sorting signals, N-terminal modifications and abundance of the chloroplast proteome. DOI: 10.1371/journal.pone.0001994 ; PMID: 18431481
- Duplication and adaptive evolution of the COR15 genes within the highly cold-tolerant Draba lineage (Brassicaceae). DOI: 10.1016/j.gene.2008.06.024 ; PMID: 18640249
- The oligomeric stromal proteome of Arabidopsis thaliana chloroplasts. DOI: 10.1074/mcp.M500180-MCP200 ; PMID: 16207701
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Gene Resources
- UniProt: A0A178VM34
- EMBL: CACRSJ010000105, CACSHJ010000088, LUHQ01000002
- AlphaFoldDB: A0A178VM34
- EnsemblPlants: AT2G42530.1
- Gramene: AT2G42530.1
- KEGG: ath:AT2G42530
- Orthologous matrix: HNVGAKQ
- ExpressionAtlas: AT2G42530
- OrthoDB: A0A178VM34
- SWISS-MODEL: A0A178VM34
Sequences
cDNA Sequence
- >AT2G42530.1
GGTTCTTAGAAATATATCTATATACTATTAGTAGTTTAACTACAGTTTGTACTTAATTGAAAAAATGTTAAAAGTTGTTTTAACCTAGCTAATTGCTAAAAATGACTAAATAGACATACACAAAGACTTGTACATTTTCAGCTTAACGACTAATACATTTTTCCTTTATATATATATCTCTATCGAGTCTAGTTATTAATGTTGAAAGTTGCAAATAAAACAGAAATGCTAACATGTAAATATCGTAGCCAAAAATGCTAACATGTGTATAACGGTTATAACCACAACTTGATGGCCGACCTCTTTTTTCTTTTGGTAACCATAGAAATGGTTACACGTAACTAGTACGAACCAACGAAAACTCTTCTTATTCGATAGTTAAAGATAATAGCAATGCGCAAAAATATCTAGCACTCACACGTGTAGTTTTGGATTCTCATTGGTCGAGAGATCTATAAAACGATACTATTGGAGGTTAGATTTTTCTCATCTCACTTTCTCCATCTTAAAACTCTTTCTTGTATTTATTTTCCTCCCAAAAAACATCTTTAAGAGTCCTCATGGCGATGTCTTTATCAGGAGCTGTTCTCAGTGGCATGGGTTCTTCTTTCCACAACGTAGGAGCAAAGCAGAGTGGTGTTGGTACCGTCAGAGTTGGCCGGAAGAGTGAGCTCGTCGTCGTTGCTCAGCGCAAGAAGTCGTTGATATACGCCGTTAAAAGTGACGGCAACATCCTCGATGACCTCAACGAAGCCACAAAGAAAGCTTCTGATTTCGTGACGGATAAGACGAAGGAGGCCTTGGCGGATGGCGAGAAAACAAAAGACTACATTGTTGAGAAAACCATTGAAGCCAATGAAACTGCGACTGAGGAAGCTAAGAAAGCTTTGGATTATGTGACTGAGAAAGGAAAAGAAGCCGGAAACAAGGCGGCTGAGTTCGTAGAGGGTAAAGCAGAAGAGGCTAAGAATGCCACAAAGTCCTGATTCAACCACTCATGTAGTCATGTTCAATAGTTTACAATAAGATCAGTTTGTTGTAATTTCTTTTTCACCATTTGAAATGAAGAGCTGTTAATTACTCACTAGCACATTTTAAATACGTATCAAATGATTTAAATATAAACTACATTTTAGTGACTACAAGTAACATAGTAGTATTTATGAGTTGGATTCGGGAAAAATCTGTCAAAATCTTCTCTCATTTTGATCCTCAATTATAAAGAAACTGTGAAACTGATGACTGTTTTTATGACAACCCCTAATAATAGCCTAAAAAGATCAAAACACCTAAAACATCAACAATTGTTATATATCCATCTCCTGAGTGAAATCTCATAGGTGTAAGGGGCAATACATACTCTCTTTGTGAATGTAGAAGAAATATTTTTTTTGTCAAAAGTTGTAACCAAAACAAAAAGAACATTGGAAGCTTAGTCCCAAGCACTTGGAGGTTCTCCACCATATCCACCACTTGAAGCACCACCATATCCACCACCATAGCCTCCTCCGCCGCCATAGCCTCCTCCACCACCATAGCCTCCTCCGCCGCCATACCCTCCTCCTCCACCGCCATAGCCTCCTC
CDS Sequence
- >AT2G42530.1
ATGGCGATGTCTTTATCAGGAGCTGTTCTCAGTGGCATGGGTTCTTCTTTCCACAACGTAGGAGCAAAGCAGAGTGGTGTTGGTACCGTCAGAGTTGGCCGGAAGAGTGAGCTCGTCGTCGTTGCTCAGCGCAAGAAGTCGTTGATATACGCCGTTAAAAGTGACGGCAACATCCTCGATGACCTCAACGAAGCCACAAAGAAAGCTTCTGATTTCGTGACGGATAAGACGAAGGAGGCCTTGGCGGATGGCGAGAAAACAAAAGACTACATTGTTGAGAAAACCATTGAAGCCAATGAAACTGCGACTGAGGAAGCTAAGAAAGCTTTGGATTATGTGACTGAGAAAGGAAAAGAAGCCGGAAACAAGGCGGCTGAGTTCGTAGAGGGTAAAGCAGAAGAGGCTAAGAATGCCACAAAGTCCTGA
Protein Sequence
- >AT2G42530.1
MAMSLSGAVLSGMGSSFHNVGAKQSGVGTVRVGRKSELVVVAQRKKSLIYAVKSDGNILDDLNEATKKASDFVTDKTKEALADGEKTKDYIVEKTIEANETATEEAKKALDYVTEKGKEAGNKAAEFVEGKAEEAKNATKS