Information report for AT2G42430
Gene Details
|
|
Functional Descriptions
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0005052 — plant callus — callo (Spanish, exact), portion of plant callus tissue (exact), 植物カルス (Japanese, exact), callus (broad)
- GO:1990110 — acts upstream of or within — callus formation
- GO:0000976 — enables — transcription cis-regulatory region binding
- GO:0009755 — involved in — hormone-mediated signaling pathway
- GO:0045893 — involved in — positive regulation of DNA-templated transcription
- GO:0005634 — located in — nucleus
- GO:1990841 — enables — promoter-specific chromatin binding
- GO:0010311 — acts upstream of or within — lateral root formation
- GO:0046982 — enables — protein heterodimerization activity
- GO:0005634 — is active in — nucleus
- GO:0010311 — involved in — lateral root formation
- lbd16-1 — Mutant plants appeared very similar to wild-type plants at both seedling and adult stages. Root growth was inhibited to almost the same extent in both wild-type and mutant seedlings in response to exogenous auxin. In addition, the lbd16-1 mutation did not affect auxin-regulated gene expression, because auxin-induced IAA5, IAA19, LBD29, and LBD33 to a similar degree in mutant and wild-type seedlings.
- lbd16-1 — The number of lateral roots was reduced slightly in 7-d old mutant seedlings compared to the wild type. Although exogenous auxin induced lateral root formation in mutant as in wild-type seedlings, there were fewer lateral roots in auxin-treated mutant than in the wild type.
Functional Keywords
Literature and News
- The lateral organ boundaries gene defines a novel, plant-specific gene family. DOI: 10.1104/pp.010926 ; PMID: 12068116
- The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper. DOI: 10.1093/pcp/pcf077 ; PMID: 12040093
- Cloning and sequencing of cDNAs for hypothetical genes from chromosome 2 of Arabidopsis. DOI: 10.1104/pp.010207 ; PMID: 12481096
- Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. DOI: 10.1104/pp.103.034736 ; PMID: 15047898
- GAL4-GFP enhancer trap lines for genetic manipulation of lateral root development in Arabidopsis thaliana. DOI: 10.1093/jxb/eri236 ; PMID: 16043452
- ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis. DOI: 10.1105/tpc.106.047761 ; PMID: 17259263
- Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members. DOI: 10.1111/j.1365-313X.2009.03797.x ; PMID: 19154202
- LBD18/ASL20 regulates lateral root formation in combination with LBD16/ASL18 downstream of ARF7 and ARF19 in Arabidopsis. DOI: 10.1104/pp.109.143685 ; PMID: 19717544
- RLF, a cytochrome b(5)-like heme/steroid binding domain protein, controls lateral root formation independently of ARF7/19-mediated auxin signaling in Arabidopsis thaliana. DOI: 10.1111/j.1365-313X.2010.04199.x ; PMID: 20230485
- The establishment of asymmetry in Arabidopsis lateral root founder cells is regulated by LBD16/ASL18 and related LBD/ASL proteins. DOI: 10.1242/dev.071928 ; PMID: 22278921
- LATERAL ORGAN BOUNDARIES DOMAIN transcription factors direct callus formation in Arabidopsis regeneration. DOI: 10.1038/cr.2012.63 ; PMID: 22508267
- Identification of nuclear localization signal in ASYMMETRIC LEAVES2-LIKE18/LATERAL ORGAN BOUNDARIES DOMAIN16 (ASL18/LBD16) from Arabidopsis. DOI: 10.1016/j.jplph.2012.04.004 ; PMID: 22591857
- Effects of three auxin-inducible LBD members on lateral root formation in Arabidopsis thaliana. DOI: 10.1007/s00425-012-1673-3 ; PMID: 22699776
- A genome-wide transcriptome profiling reveals the early molecular events during callus initiation in Arabidopsis multiple organs. DOI: 10.1016/j.ygeno.2012.05.013 ; PMID: 22664253
- Role of a respiratory burst oxidase of Lepidium sativum (cress) seedlings in root development and auxin signalling. DOI: 10.1093/jxb/ers284 ; PMID: 23095998
- Direct activation of EXPANSIN14 by LBD18 in the gene regulatory network of lateral root formation in Arabidopsis. DOI: 10.4161/psb.22979 ; PMID: 23299420
- The AP2/EREBP gene PUCHI Co-Acts with LBD16/ASL18 and LBD18/ASL20 downstream of ARF7 and ARF19 to regulate lateral root development in Arabidopsis. DOI: 10.1093/pcp/pct081 ; PMID: 23749813
- A secreted peptide acts on BIN2-mediated phosphorylation of ARFs to potentiate auxin response during lateral root development. DOI: 10.1038/ncb2893 ; PMID: 24362628
- WOX11 and 12 are involved in the first-step cell fate transition during de novo root organogenesis in Arabidopsis. DOI: 10.1105/tpc.114.122887 ; PMID: 24642937
- An undergraduate study of two transcription factors that promote lateral root formation. DOI: 10.1002/bmb.20780 ; PMID: 24615800
- A role for LATERAL ORGAN BOUNDARIES-DOMAIN 16 during the interaction Arabidopsis-Meloidogyne spp. provides a molecular link between lateral root and root-knot nematode feeding site development. DOI: 10.1111/nph.12826 ; PMID: 24803293
- An Arabidopsis gene regulatory network for secondary cell wall synthesis. DOI: 10.1038/nature14099 ; PMID: 25533953
- Genes co-regulated with LBD16 in nematode feeding sites inferred from in silico analysis show similarities to regulatory circuits mediated by the auxin/cytokinin balance in Arabidopsis. DOI: 10.4161/15592324.2014.990825 ; PMID: 25664644
- Lateral Organ Boundaries Domain16 and 18 Act Downstream of the AUXIN1 and LIKE-AUXIN3 Auxin Influx Carriers to Control Lateral Root Development in Arabidopsis. DOI: 10.1104/pp.15.00578 ; PMID: 26059335
- Dimerization in LBD16 and LBD18 Transcription Factors Is Critical for Lateral Root Formation. DOI: 10.1104/pp.17.00013 ; PMID: 28336771
- Molecular Transducers from Roots Are Triggered in Arabidopsis Leaves by Root-Knot Nematodes for Successful Feeding Site Formation: A Conserved Post-Embryogenic De novo Organogenesis Program? DOI: 10.3389/fpls.2017.00875 ; PMID: 28603536
- High-temperature promotion of callus formation requires the BIN2-ARF-LBD axis in Arabidopsis. DOI: 10.1007/s00425-017-2747-z ; PMID: 28766014
- LBD14/ASL17 Positively Regulates Lateral Root Formation and is Involved in ABA Response for Root Architecture in Arabidopsis. DOI: 10.1093/pcp/pcx153 ; PMID: 29040694
- Coiled-coil motif in LBD16 and LBD18 transcription factors are critical for dimerization and biological function in arabidopsis. DOI: 10.1080/15592324.2017.1411450 ; PMID: 29227192
- The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture. DOI: 10.1093/pcp/pcy010 ; PMID: 29361138
- Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration. DOI: 10.1038/s41477-017-0095-4 ; PMID: 29358751
- LBD18 uses a dual mode of a positive feedback loop to regulate ARF expression and transcriptional activity in Arabidopsis. DOI: 10.1111/tpj.13945 ; PMID: 29681137
- JMJ30-mediated demethylation of H3K9me3 drives tissue identity changes to promote callus formation in Arabidopsis. DOI: 10.1111/tpj.14002 ; PMID: 29923261
- Pivotal role of LBD16 in root and root-like organ initiation. DOI: 10.1007/s00018-018-2861-5 ; PMID: 29943076
- The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots. DOI: 10.1104/pp.17.01713 ; PMID: 30026290
- Role of LBD14 during ABA-mediated control of root system architecture in Arabidopsis. DOI: 10.1080/15592324.2018.1507405 ; PMID: 30125143
- Lateral Inhibition by a Peptide Hormone-Receptor Cascade during Arabidopsis Lateral Root Founder Cell Formation. DOI: 10.1016/j.devcel.2018.11.031 ; PMID: 30581155
- LBD13 positively regulates lateral root formation in Arabidopsis. DOI: 10.1007/s00425-018-03087-x ; PMID: 30627888
- Endogenous Hypoxia in Lateral Root Primordia Controls Root Architecture by Antagonizing Auxin Signaling in Arabidopsis. DOI: 10.1016/j.molp.2019.01.007 ; PMID: 30641154
- LBD16 and LBD18 acting downstream of ARF7 and ARF19 are involved in adventitious root formation in Arabidopsis. DOI: 10.1186/s12870-019-1659-4 ; PMID: 30704405
- Lateral root initiation requires the sequential induction of transcription factors LBD16 and PUCHI in Arabidopsis thaliana. DOI: 10.1111/nph.16065 ; PMID: 31310684
- Reactive oxygen species and reactive carbonyl species constitute a feed-forward loop in auxin signaling for lateral root formation. DOI: 10.1111/tpj.14456 ; PMID: 31306517
- Auxin abolishes SHI-RELATED SEQUENCE5-mediated inhibition of lateral root development in Arabidopsis. DOI: 10.1111/nph.16115 ; PMID: 31403703
- AtHB23 participates in the gene regulatory network controlling root branching, and reveals differences between secondary and tertiary roots. DOI: 10.1111/tpj.14511 ; PMID: 31444832
- Histone acetylation orchestrates wound-induced transcriptional activation and cellular reprogramming in Arabidopsis. DOI: 10.1038/s42003-019-0646-5 ; PMID: 31701032
- PRH1 mediates ARF7-LBD dependent auxin signaling to regulate lateral root development in Arabidopsis thaliana. DOI: 10.1371/journal.pgen.1008044 ; PMID: 32032352
- Lateral root development differs between main and secondary roots and depends on the ecotype. DOI: 10.1080/15592324.2020.1755504 ; PMID: 32310024
- A Gain-of-Function Mutant of IAA15 Inhibits Lateral Root Development by Transcriptional Repression of LBD Genes in Arabidopsis. DOI: 10.3389/fpls.2020.01239 ; PMID: 32903377
- Early Low-Fluence Red Light or Darkness Modulates the Shoot Regeneration Capacity of Excised Arabidopsis Roots. DOI: 10.3390/plants9101378 ; PMID: 33081176
- Pickle Recruits Retinoblastoma Related 1 to Control Lateral Root Formation in Arabidopsis. DOI: 10.3390/ijms22083862 ; PMID: 33917959
- Phytochrome-interacting factors orchestrate hypocotyl adventitious root initiation in Arabidopsis. DOI: 10.1242/dev.200362 ; PMID: 35502748
- GIGANTEA regulates lateral root formation by modulating auxin signaling in Arabidopsis thaliana. DOI: 10.1080/15592324.2022.2096780 ; PMID: 35822517
- Phosphorylation of the auxin signaling transcriptional repressor IAA15 by MPKs is required for the suppression of root development under drought stress in Arabidopsis. DOI: 10.1093/nar/gkac798 ; PMID: 36161329
- Control of lateral root initiation by DA3 in Arabidopsis. DOI: 10.1016/j.celrep.2022.111913 ; PMID: 36640335
- Divergent regulation of auxin responsive genes in root-knot and cyst nematodes feeding sites formed in Arabidopsis. DOI: 10.3389/fpls.2023.1024815 ; PMID: 36875577
- TOR acts as a metabolic gatekeeper for auxin-dependent lateral root initiation in Arabidopsis thaliana. DOI: 10.15252/embj.2022111273 ; PMID: 37021425
Gene Resources
Homologs
- Brassica napus GSBRNA2T00084710001, GSBRNA2T00088594001, GSBRNA2T00097086001, GSBRNA2T00019165001, GSBRNA2T00042308001
- Brassica oleracea XP_013635196.1, XP_013627460.1, XP_013635399.1
- Brassica rapa XP_009142063.1, XP_009142837.1, XP_009133536.1
- Raphanus raphanistrum RrC156_p3, RrC14353_p1, RrC4772_p1
Sequences
cDNA Sequence
- >AT2G42430.1
GCCCAAGAAAGAAAAGAAAAAAAAAAAACTCTTTCTCTCTCATGATAATGTTCCTTTTATAAAATCCACCCAAAGACACCAAACACTTCTCCATCATCATTTCATTTCTTGTTCTTTTTCCACCATCACCATTTCCTAGTTCGCTCGTGCACATCTCCGACGATCCCAATTCTAAAATCATCACTTCTTCCAATCTTTTCAACATCTCTTCAAAATATCCAGTCAACAAAAAAAAAAGTACTTAAAACAAGGAAACCCCTTCTTTCTTTTTGTACATATAACATAAAAATCATCACTTTTTTGTTCGTTTCGCCGATGGCATCTTCCGGTAACGGTACAACGGCGGGGACAGGTTCACCATGCGGTGCATGCAAGTTCTTGAGGAGGAAGTGCGCATCCGATTGTATATTTGCACCGTACTTCTCATCGGAGCAAGGAGCAGCAAGATTCGCAGCTATTCACAAGGTGTTTGGAGCAAGCAACGTTTCTAAGCTCTTGCTTAATGTTCCAATCCATGATCGATGTGAAGCTGTCGTCACCATCGCCTACGAAGCTCAGGCTCGTCTTCATGACCCTGTTTATGGATGTGTCTCTCATATCTTTGCCCTCCAACAACAGGTGGCTTTCTTGCAATCACAAGTCATGCAAATGAAGGCACAGATAGCTGGCCACCAGACGTCAGCCGCCGGAGATCTAAGACACAGCTCGGAAAGTACCAACCAGTTTATGACGTGGCAACAAACTAGTGTCTCTCCGATCGGTAGTGCATACTCAACACCGTATAACCATCATCAACCTTACTACGGTCATGTAAACCCTAACAATCCGGTCTCGCCACAGAGCTCGCTAGAAGAATCTTTCAGCAACACGAGCAGTGACGTCACCACAACAGCCAACGTGCGAGAGACTCATCATCAAACCGGAGGAGGAGTATACGGTCACGATGGAATAGGGTTTCACGAAGGATATCCTAACAAGAAGAGATCAGTGAGTTATTGTAGTAGCGATTTAGGTGAGCTTCAGGCTTTGGCTCTTAGAATGATGAAGAACTAAGATAAGTTGGTAAGTTATGTAGACAGTCAGAGAACAAATGAGATGTTTTTATTCGAAGAAAAAAAAAACAAGACAATAGAACATTCCATGTTCACATGCTATCATCAATAAGATGTCTACTACACATCCATGTTTGCTTTAAGTCACTGGCCATTGATCAATCACTGAAATATTTGACTTGACA
CDS Sequence
- >AT2G42430.1
ATGGCATCTTCCGGTAACGGTACAACGGCGGGGACAGGTTCACCATGCGGTGCATGCAAGTTCTTGAGGAGGAAGTGCGCATCCGATTGTATATTTGCACCGTACTTCTCATCGGAGCAAGGAGCAGCAAGATTCGCAGCTATTCACAAGGTGTTTGGAGCAAGCAACGTTTCTAAGCTCTTGCTTAATGTTCCAATCCATGATCGATGTGAAGCTGTCGTCACCATCGCCTACGAAGCTCAGGCTCGTCTTCATGACCCTGTTTATGGATGTGTCTCTCATATCTTTGCCCTCCAACAACAGGTGGCTTTCTTGCAATCACAAGTCATGCAAATGAAGGCACAGATAGCTGGCCACCAGACGTCAGCCGCCGGAGATCTAAGACACAGCTCGGAAAGTACCAACCAGTTTATGACGTGGCAACAAACTAGTGTCTCTCCGATCGGTAGTGCATACTCAACACCGTATAACCATCATCAACCTTACTACGGTCATGTAAACCCTAACAATCCGGTCTCGCCACAGAGCTCGCTAGAAGAATCTTTCAGCAACACGAGCAGTGACGTCACCACAACAGCCAACGTGCGAGAGACTCATCATCAAACCGGAGGAGGAGTATACGGTCACGATGGAATAGGGTTTCACGAAGGATATCCTAACAAGAAGAGATCAGTGAGTTATTGTAGTAGCGATTTAGGTGAGCTTCAGGCTTTGGCTCTTAGAATGATGAAGAACTAA
Protein Sequence
- >AT2G42430.1
MASSGNGTTAGTGSPCGACKFLRRKCASDCIFAPYFSSEQGAARFAAIHKVFGASNVSKLLLNVPIHDRCEAVVTIAYEAQARLHDPVYGCVSHIFALQQQVAFLQSQVMQMKAQIAGHQTSAAGDLRHSSESTNQFMTWQQTSVSPIGSAYSTPYNHHQPYYGHVNPNNPVSPQSSLEESFSNTSSDVTTTANVRETHHQTGGGVYGHDGIGFHEGYPNKKRSVSYCSSDLGELQALALRMMKN