Gene Details:

  • Gene ID: AT2G40220
  • Gene Symbol: ABI4, ATABI4, GIN6, ISI3, SAN5, SIS5, SUN6
  • Gene Name: ABA INSENSITIVE 4, GLUCOSE INSENSITIVE 6, IMPAIRED SUCROSE INDUCTION 3, SALOBRENO 5, SUGAR-INSENSITIVE 5, SUCROSE UNCOUPLED 6
  • Description: Integrase-type DNA-binding superfamily protein;(source:Araport11)
  • TAIR Accession:
  • Genome: Araport11_genome_release
  • Species: Arabidopsis thaliana

Transcripts:

Plant Ontology Annotations:

  • PO:0009009  — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
  • PO:0000025  — root tip — punta de la raíz (Spanish, exact), 根端 (Japanese, exact)
  • PO:0020149  — quiescent center — centro de division de células del meristema (Spanish, exact), 静止中心 (Japanese, exact)
  • PO:0009010  — seed — semilla (Spanish, exact), 種子 (Japanese, exact), pyrene (narrow), diaspore (broad)

Germplasm Phenotype:

  • CS3836  — abscisic acid resistant, reduced sensitivity to ABA inhibition of germination, germinates in the presence of 5 microM ABA; dormancy response appears to be as expected for abi4; reduced sensitivity to the inhibitory effects of sugars on early seedling development, germinates and forms seedlings with expanded cotyledons and true leaves on concentrations of glucose (0.3 M), sucrose (0.3 M), mannose (2mM) or sorbitol (0.4 M) that inhibit these processes in wt plants; decreased sensitivity to the presence of the GA biosynthesis inhibitor paclobutrazol (35 mg/L ); does not exhibit compromised water relations, not wilty; lacks trichomes on stems and leaves due to background gl mutation, some trichomes in leaf margins.
  • CS3837  — Mutant root growth was already somewhat reduced compared to WT plants under normal growth conditions but was significantly less sensitive to inhibition by 25 mM trehalose. Root length was reduced only by 46% compared to 90% in WT plants (Fig. 1B). The germination rates on trehalose were identical to those on medium without trehalose indicating that the smaller roots are not caused by delayed or deficient germination.
  • CS3837  — The inhibition of root growth in WT plants by trehalose could be overcome by bypassing the need for starch breakdown through continuous light. Partial effects were observed with long day conditions (16 h/8 h light/dark regime). However, continuous light could not overcome the effects of trehalose on gene expression (AT1G10760, AT4G17090, AT5G16150), or starch accumulation in the cotyledons.
  • CS3837  — abscisic acid resistant, reduced sensitivity to ABA inhibition of germination, germinates in the presence of 5 microM ABA; dormancy response appears to be as expected for abi4; reduced sensitivity to the inhibitory effects of sugars on early seedling development, germinates and forms seedlings with expanded cotyledons and true leaves on concentrations of glucose (0.3 M), sucrose (0.3 M) or sorbitol (0.4 M) that inhibit these processes in wt plants; slightly decreased sensitivity to mannose (2mM) on germination and early seedling development; decreased sensitivity to the presence of the GA biosynthesis inhibitor paclobutrazol (35mg/L ); does not exhibit compromised water relations, not wilty.
  • CS3838  — abscisic acid resistant, reduced sensitivity to ABA inhibition of germination, germinates in the presence of 5 microM ABA; dormancy response appears to be as expected for abi4; reduced sensitivity to the inhibitory effects of sugars on early seedling development, germinates and forms seedlings with expanded cotyledons and true leaves on concentrations of glucose (0.3 M) , sucrose (0.3 M), mannose (2mM) or sorbitol (0.4 M) that inhibit these processes in wt plants; decreased sensitivity to the presence of the GA biosynthesis inhibitor paclobutrazol (35 mg/L ); does not exhibit compromised water relations, not wilty; lacks trichomes on stems and leaves due to gl mutation, some trichomes in leaf margins.
  • CS3839  — abscisic acid resistant, reduced sensitivity to ABA inhibition of germination, germinates in the presence of 5 microM ABA; dormancy response appears to be as expected for abi4; reduced sensitivity to the inhibitory effects of sugars on early seedling development, germinates and forms seedlings with expanded cotyledons and true leaves on concentrations of glucose (0.3 M), sucrose (0.3 M), mannose (2mM) or sorbitol (0.4 M) that inhibit these processes in wt plants; decreased sensitivity to the presence of the GA biosynthesis inhibitor paclobutrazol (35 mg/L ); does not exhibit compromised water relations, not wilty; lacks trichomes on stems and leaves due to background gl mutation, some trichomes in leaf margins.
  • CS8104  — Increased susceptibility to P. irregulare compared with the wild type.
  • CS8104  — abscisic acid resistant, reduced sensitivity to ABA inhibition of germination, germinates in the presence of 5 microM ABA; does not exhibit compromised water relations, normal stomatal regulation, not wilty phenotype; seed dormancy similar to wt; reduced sensitivity to salt and osmotic stress during germination; decreased accumulation of storage reserves and products of some late-embryogenesis abundant genes.
  • abi4-1 bps1-2  — Double mutants were indistinguishable from bps1 single mutants.
  • sos5-1/abi4-1  — Abnormal root growth on NaCl free media.

Literature:

Sequences:

cDNA Sequence
  • >AT2G40220.1
    ATGGACCCTTTAGCTTCCCAACATCAACACAACCATCTGGAAGATAATAACCAAACCCTAACCCATAATAATCCTCAATCCGATTCCACCACCGACTCATCAACTTCCTCCGCTCAACGCAAACGCAAAGGCAAAGGTGGTCCGGACAACTCCAAGTTCCGTTACCGTGGCGTTCGACAAAGAAGCTGGGGCAAATGGGTCGCCGAGATCCGAGAGCCACGTAAGCGCACTCGCAAGTGGCTTGGTACTTTCGCAACCGCCGAAGACGCCGCACGTGCCTACGACCGGGCTGCCGTTTACCTATACGGGTCACGTGCTCAGCTCAACTTAACCCCTTCGTCTCCTTCCTCCGTCTCTTCCTCTTCCTCCTCCGTCTCCGCCGCTTCTTCTCCTTCCACCTCCTCTTCCTCCACTCAAACCCTAAGACCTCTCCTCCCTCGCCCCGCCGCCGCCACCGTAGGAGGAGGAGCCAACTTTGGTCCGTACGGTATCCCTTTTAACAACAACATCTTCCTTAATGGTGGGACCTCTATGTTATGCCCTAGTTATGGTTTTTTCCCTCAACAACAACAACAACAAAATCAGATGGTCCAGATGGGACAATTCCAACACCAACAGTATCAGAATCTTCATTCTAATACTAACAATAACAAGATTTCTGACATCGAGCTCACTGATGTTCCGGTAACTAATTCGACTTCGTTTCATCATGAGGTGGCGTTAGGGCAGGAACAAGGAGGAAGTGGGTGTAATAATAATAGTTCGATGGAGGATTTGAACTCTCTAGCTGGTTCGGTGGGTTCGAGTCTATCAATAACTCATCCACCGCCGTTGGTTGATCCGGTATGTTCTATGGGTCTGGATCCGGGTTATATGGTTGGAGATGGATCTTCGACCATTTGGCCTTTTGGAGGAGAAGAAGAATATAGTCATAATTGGGGGAGTATTTGGGATTTTATTGATCCCATCTTGGGGGAATTCTATTAATTTGTTTTTGTGGAAGATCATATTATATACGATGAGCATCCCTAAGGTCGGTCAAGAGCATTGGAGATTCATTGTTGAGAGGAATCAAAGAGATTGCATTCTATGAGGAGCTCTGCATGCAAAATTTTGGAGGATTTTTTTACTACCTATAGAGATAAATAAGAGGGTATTTTTATTATTTTTTTGAAGATTTTTATTTTCAAGGAATTCGTAAAAGAGATTACGGTTCCAATAAAGTATGTATATGTGGAAGAGAATCGGAGGAGATGGTGGAAAGTTGTATGGGAATTTTATTGGTTCAACACTTCCTTCACAGTGTGCCTACCTTAATATATAATTATTGATAGGATAT
CDS Sequence
  • >AT2G40220.1
    ATGGACCCTTTAGCTTCCCAACATCAACACAACCATCTGGAAGATAATAACCAAACCCTAACCCATAATAATCCTCAATCCGATTCCACCACCGACTCATCAACTTCCTCCGCTCAACGCAAACGCAAAGGCAAAGGTGGTCCGGACAACTCCAAGTTCCGTTACCGTGGCGTTCGACAAAGAAGCTGGGGCAAATGGGTCGCCGAGATCCGAGAGCCACGTAAGCGCACTCGCAAGTGGCTTGGTACTTTCGCAACCGCCGAAGACGCCGCACGTGCCTACGACCGGGCTGCCGTTTACCTATACGGGTCACGTGCTCAGCTCAACTTAACCCCTTCGTCTCCTTCCTCCGTCTCTTCCTCTTCCTCCTCCGTCTCCGCCGCTTCTTCTCCTTCCACCTCCTCTTCCTCCACTCAAACCCTAAGACCTCTCCTCCCTCGCCCCGCCGCCGCCACCGTAGGAGGAGGAGCCAACTTTGGTCCGTACGGTATCCCTTTTAACAACAACATCTTCCTTAATGGTGGGACCTCTATGTTATGCCCTAGTTATGGTTTTTTCCCTCAACAACAACAACAACAAAATCAGATGGTCCAGATGGGACAATTCCAACACCAACAGTATCAGAATCTTCATTCTAATACTAACAATAACAAGATTTCTGACATCGAGCTCACTGATGTTCCGGTAACTAATTCGACTTCGTTTCATCATGAGGTGGCGTTAGGGCAGGAACAAGGAGGAAGTGGGTGTAATAATAATAGTTCGATGGAGGATTTGAACTCTCTAGCTGGTTCGGTGGGTTCGAGTCTATCAATAACTCATCCACCGCCGTTGGTTGATCCGGTATGTTCTATGGGTCTGGATCCGGGTTATATGGTTGGAGATGGATCTTCGACCATTTGGCCTTTTGGAGGAGAAGAAGAATATAGTCATAATTGGGGGAGTATTTGGGATTTTATTGATCCCATCTTGGGGGAATTCTATTAA
Protein Sequence
  • >AT2G40220.1
    MDPLASQHQHNHLEDNNQTLTHNNPQSDSTTDSSTSSAQRKRKGKGGPDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQLNLTPSSPSSVSSSSSSVSAASSPSTSSSSTQTLRPLLPRPAAATVGGGANFGPYGIPFNNNIFLNGGTSMLCPSYGFFPQQQQQQNQMVQMGQFQHQQYQNLHSNTNNNKISDIELTDVPVTNSTSFHHEVALGQEQGGSGCNNNSSMEDLNSLAGSVGSSLSITHPPPLVDPVCSMGLDPGYMVGDGSSTIWPFGGEEEYSHNWGSIWDFIDPILGEFY