Information report for AT2G33150
Gene Details
|
|
Functional Descriptions
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0025195 — pollen tube cell — célula del tubo polínico (Spanish, exact), 花粉管細胞 (Japanese, exact)
- GO:0010124 — involved in — phenylacetate catabolic process
- GO:0005739 — located in — mitochondrion
- GO:0006635 — involved in — fatty acid beta-oxidation
- GO:0009789 — acts upstream of or within — positive regulation of abscisic acid-activated signaling pathway
- GO:0003988 — enables — acetyl-CoA C-acyltransferase activity
- GO:0006635 — acts upstream of or within — fatty acid beta-oxidation
- GO:0000325 — located in — plant-type vacuole
- GO:0005777 — located in — peroxisome
- GO:0019395 — acts upstream of or within — fatty acid oxidation
- GO:0009695 — acts upstream of or within — jasmonic acid biosynthetic process
- GO:0005515 — enables — protein binding
- GO:0005783 — located in — endoplasmic reticulum
- GO:0005730 — located in — nucleolus
- GO:0010111 — acts upstream of or within — glyoxysome organization
- GO:0009611 — acts upstream of or within — response to wounding
- GO:0009507 — located in — chloroplast
- GO:0005777 — is active in — peroxisome
- CS2105643 — Requires sucrose for germination and seedling establishment
- CS2105644 — Requires sucrose for germination and seedling establishment. Seed ages quickly
- CS2105645 — Unusual kat2 allele
- CS2105646 — Requires sucrose for germination and seedling establishment
- CS2105647 — Requires sucrose for germination and seedling establishment
- ped1 — Resistant to 2,4-dichlorophyenoxybutyric acid, etiolated cotyledons
Functional Keywords
- shoot axis apex , leaf lamina base , root , shoot system , plant embryo , vascular leaf , stamen , sepal , flower , inflorescence flower pedicel , cotyledon , petiole , hypocotyl , leaf apex , collective leaf structure , pollen , pollen , pollen , pollen tube cell , pollen
Literature and News
- 2,4-Dichlorophenoxybutyric acid-resistant mutants of Arabidopsis have defects in glyoxysomal fatty acid beta-oxidation. DOI: 10.1105/tpc.10.2.183 ; PMID: 9490742
- Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins. DOI: 10.1105/tpc.016055 ; PMID: 14671022
- Lipoic acid-dependent oxidative catabolism of alpha-keto acids in mitochondria provides evidence for branched-chain amino acid catabolism in Arabidopsis. DOI: 10.1104/pp.103.035675 ; PMID: 14764908
- Proteomic analysis and extensive protein identification from dry, germinating Arabidopsis seeds and young seedlings. DOI: 10.5483/bmbrep.2005.38.6.650 ; PMID: 16336779
- Nine 3-ketoacyl-CoA thiolases (KATs) and acetoacetyl-CoA thiolases (ACATs) encoded by five genes in Arabidopsis thaliana are targeted either to peroxisomes or cytosol but not to mitochondria. DOI: 10.1007/s11103-006-9075-1 ; PMID: 17120136
- Proteome analysis of Arabidopsis leaf peroxisomes reveals novel targeting peptides, metabolic pathways, and defense mechanisms. DOI: 10.1105/tpc.107.050989 ; PMID: 17951448
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. DOI: 10.1104/pp.108.126375 ; PMID: 18775970
- Turnover of fatty acids during natural senescence of Arabidopsis, Brachypodium, and switchgrass and in Arabidopsis beta-oxidation mutants. DOI: 10.1104/pp.109.140491 ; PMID: 19561121
- The ABC transporter PXA1 and peroxisomal beta-oxidation are vital for metabolism in mature leaves of Arabidopsis during extended darkness. DOI: 10.1105/tpc.108.064857 ; PMID: 19794119
- Peroxisomal plant 3-ketoacyl-CoA thiolase structure and activity are regulated by a sensitive redox switch. DOI: 10.1074/jbc.M110.106013 ; PMID: 20463027
- Arabidopsis 3-ketoacyl-CoA thiolase-2 (KAT2), an enzyme of fatty acid β-oxidation, is involved in ABA signal transduction. DOI: 10.1093/pcp/pcr008 ; PMID: 21257607
- Species specific amino acid sequence-protein local structure relationships: An analysis in the light of a structural alphabet. DOI: 10.1016/j.jtbi.2011.01.047 ; PMID: 21333657
- Conservation of two lineages of peroxisomal (Type I) 3-ketoacyl-CoA thiolases in land plants, specialization of the genes in Brassicaceae, and characterization of their expression in Arabidopsis thaliana. DOI: 10.1093/jxb/ers260 ; PMID: 23066143
- Genetic dissection of peroxisome-associated matrix protein degradation in Arabidopsis thaliana. DOI: 10.1534/genetics.112.146100 ; PMID: 23150599
- Acyl-lipid metabolism. DOI: 10.1199/tab.0161 ; PMID: 23505340
- Peroxisomal ATP-binding cassette transporter COMATOSE and the multifunctional protein abnormal INFLORESCENCE MERISTEM are required for the production of benzoylated metabolites in Arabidopsis seeds. DOI: 10.1104/pp.113.229807 ; PMID: 24254312
- Knockout of the two evolutionarily conserved peroxisomal 3-ketoacyl-CoA thiolases in Arabidopsis recapitulates the abnormal inflorescence meristem 1 phenotype. DOI: 10.1093/jxb/eru397 ; PMID: 25297549
- Sucrose Production Mediated by Lipid Metabolism Suppresses the Physical Interaction of Peroxisomes and Oil Bodies during Germination of Arabidopsis thaliana. DOI: 10.1074/jbc.M116.748814 ; PMID: 27466365
- Arabidopsis SFAR4 is a novel GDSL-type esterase involved in fatty acid degradation and glucose tolerance. DOI: 10.1186/s40529-015-0114-6 ; PMID: 28510842
- The endophytic fungus Piriformospora indica enhances Arabidopsis thaliana growth and modulates Na(+)/K(+) homeostasis under salt stress conditions. DOI: 10.1016/j.plantsci.2017.07.006 ; PMID: 28818365
- Peroxisomal β-oxidation regulates histone acetylation and DNA methylation in Arabidopsis. DOI: 10.1073/pnas.1904143116 ; PMID: 31064880
- Metabolic Alterations in the Enoyl-CoA Hydratase 2 Mutant Disrupt Peroxisomal Pathways in Seedlings. DOI: 10.1104/pp.19.00300 ; PMID: 31138624
- Chloroplast Protein Tic55 Involved in Dark-Induced Senescence through AtbHLH/AtWRKY-ANAC003 Controlling Pathway of Arabidopsis thaliana. DOI: 10.3390/genes13020308 ; PMID: 35205352
- Direct interaction between glyoxysomes and lipid bodies in cotyledons of the Arabidopsis thaliana ped1 mutant. DOI: 10.1007/BF01288364 ; PMID: 11732324
- Requirement for 3-ketoacyl-CoA thiolase-2 in peroxisome development, fatty acid beta-oxidation and breakdown of triacylglycerol in lipid bodies of Arabidopsis seedlings. DOI: 10.1046/j.1365-313x.2001.01095.x ; PMID: 11696182
- Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins. DOI: 10.1105/tpc.016055 ; PMID: 14671022
- Lipoic acid-dependent oxidative catabolism of alpha-keto acids in mitochondria provides evidence for branched-chain amino acid catabolism in Arabidopsis. DOI: 10.1104/pp.103.035675 ; PMID: 14764908
- The Arabidopsis thaliana chloroplast proteome reveals pathway abundance and novel protein functions. DOI: 10.1016/j.cub.2004.02.039 ; PMID: 15028209
- Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions. DOI: 10.1091/mbc.e04-09-0791 ; PMID: 15496452
- Sucrose rescues seedling establishment but not germination of Arabidopsis mutants disrupted in peroxisomal fatty acid catabolism. DOI: 10.1111/j.1365-313X.2005.02498.x ; PMID: 16146525
- Proteome mapping of mature pollen of Arabidopsis thaliana. DOI: 10.1002/pmic.200402011 ; PMID: 16247729
- A reference map of the Arabidopsis thaliana mature pollen proteome. DOI: 10.1016/j.bbrc.2005.09.185 ; PMID: 16242667
- Analysis of the role of COMATOSE and peroxisomal beta-oxidation in the determination of germination potential in Arabidopsis. DOI: 10.1093/jxb/erl045 ; PMID: 16844736
- A proteomics dissection of Arabidopsis thaliana vacuoles isolated from cell culture. DOI: 10.1074/mcp.M600250-MCP200 ; PMID: 17151019
- Membrane proteomic analysis of Arabidopsis thaliana using alternative solubilization techniques. DOI: 10.1021/pr060525b ; PMID: 17432890
- The Arabidopsis 3-ketoacyl-CoA thiolase-2 (kat2-1) mutant exhibits increased flowering but reduced reproductive success. DOI: 10.1093/jxb/erm146 ; PMID: 17728299
- Proteome analysis of Arabidopsis leaf peroxisomes reveals novel targeting peptides, metabolic pathways, and defense mechanisms. DOI: 10.1105/tpc.107.050989 ; PMID: 17951448
- Expression of the beta-oxidation gene 3-ketoacyl-CoA thiolase 2 (KAT2) is required for the timely onset of natural and dark-induced leaf senescence in Arabidopsis. DOI: 10.1093/jxb/ern079 ; PMID: 18441338
- Analysis of the Arabidopsis cytosolic proteome highlights subcellular partitioning of central plant metabolism. DOI: 10.1021/pr1009433 ; PMID: 21166475
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
Gene Resources
- UniProt: A0A178VRP9
- EMBL: CACRSJ010000105, CACSHJ010000088, LR881467
- AlphaFoldDB: A0A178VRP9
- EnsemblPlants: AT2G33150.1
- Gramene: AT2G33150.1
- KEGG: ath:AT2G33150
- Orthologous matrix: RWCASSM
- ExpressionAtlas: AT2G33150
- InterPro: IPR002155, IPR016039, IPR020610
- PANTHER: PTHR43853, PTHR43853:SF8
- SUPFAM: SSF53901
- PROSITE: PS00098, PS00099, PS00737
- Gene3D: 3.40.47.10
- OrthoDB: A0A178VRP9
- SWISS-MODEL: A0A178VRP9
- Conserved Domain Database: cd00751
Homologs
- Zea mays Zm00001d036640, Zm00001d034316, Zm00001d031731
Sequences
cDNA Sequence
- >AT2G33150.1
CCTAATCTTATCTTCTTCTATCACACTCTCAGCTTATCTATGACTATGACTCTCATCATCAATTATTTCACACTATTAACAATCACCAAACCAGTGTGAACATTTTAATTCATAATTAGAGTAAGGTCATTAGGCTAAAAACTGTTTGATTTGGATTTTACAACTATAGGATAAGAACTTGTATCGCTGTCACAGATGATATTTTTTGGTCGTTTAAGCAAAGAAATATTACGAAAAAGAGATATTTTTTATTCTTACTTATTTTGGGATTATCATTTACCCGGAACGGGCAAAGCGGTGAGTCATCTTACCTTATAAATGATCACAAACCCGAGGACTGTGAGTTTTCGTGTAGAACAAATCCTTCTCTGAGAAAAAACAACAGATCCGAATTTTATCTTTAATCAGCCGGAAAAAATGGAGAAAGCGATCGAGAGACAACGCGTTCTTCTTGAGCATCTCCGACCTTCTTCTTCTTCTTCGCACAATTACGAGGCTTCTCTATCTGCTTCTGCTTGCTTGGCTGGGGACAGTGCTGCATATCAGAGGACCTCTCTCTATGGAGATGATGTTGTCATTGTCGCGGCACATAGGACTCCACTATGCAAGTCCAAACGTGGCAATTTCAAGGATACATATCCCGATGATTTGCTCGCACCTGTTTTGAGGGCATTGATAGAGAAGACGAATCTAAACCCAAGTGAAGTAGGTGACATTGTTGTGGGTACTGTTTTGGCACCTGGATCTCAGAGAGCCAGTGAATGCAGGATGGCTGCGTTCTATGCTGGTTTCCCTGAAACCGTGGCTGTCAGAACTGTGAATAGACAGTGCTCATCTGGGCTTCAGGCTGTTGCTGATGTAGCCGCTGCCATTAAAGCGGGATTTTATGACATTGGTATCGGGGCTGGTTTGGAGTCCATGACTACCAATCCAATGGCATGGGAAGGGTCAGTCAACCCAGCGGTGAAGAAGTTTGCACAAGCGCAGAATTGTCTTCTTCCTATGGGTGTTACGTCAGAAAATGTAGCACAACGCTTTGGTGTCTCAAGGCAGGAGCAAGATCAAGCTGCTGTTGACTCGCACAGAAAGGCAGCTGCTGCTACTGCTGCTGGTAAATTCAAGGATGAGATCATTCCTGTTAAGACCAAGCTTGTTGACCCGAAGACTGGTGATGAGAAACCCATTACAGTTTCTGTTGATGATGGTATCCGACCAACCACAACTCTTGCTTCTCTTGGGAAGCTGAAGCCAGTGTTTAAGAAGGATGGCACCACTACTGCTGGAAATTCCAGCCAAGTAAGTGATGGTGCAGGAGCGGTTCTCCTAATGAAGAGAAGTGTTGCAATGCAAAAAGGACTTCCCGTTCTTGGTGTATTCAGGACATTTGCTGCAGTTGGTGTTGACCCTGCAATCATGGGTATCGGTCCAGCAGTTGCCATTCCTGCTGCAGTTAAGGCGGCTGGTTTAGAACTTGATGACATCGACTTGTTTGAGATCAATGAGGCATTTGCATCTCAGTTTGTTTATTGCCGTAACAAATTGGGACTTGACCCAGAGAAAATCAATGTCAACGGAGGTGCAATGGCCATAGGCCATCCTTTGGGCGCTACAGGAGCGCGTTGTGTTGCTACATTGTTGCACGAGATGAAACGCCGTGGTAAAGACTGCCGTTTTGGAGTAGTGTCAATGTGCATTGGGACGGGGATGGGTGCAGCAGCTGTGTTTGAGAGAGGAGATGGAGTTGATGAGCTTCGCAACGCAAGGAAAGTTGAAGCGCAAGGTCTTTTGTCCAAGGACGCTCGCTAGAGAGGACCATGCACCAAAACCGTTTTTCACCTCACCTCTCTCTTTTCTGGTCTTCTTGTCACTTTCTTCAGATATTATTATAGTTTCGAATAAAGCACACAACCAATGTTTGCCTGAGTCTTGTGTTGTTCTTGACCAGGTCATGTGTTTAGTATTTTTTTTAAGTGAAGGGGGATAATCTTTAAATCTTTTATATGTAAGAATATTGTTCTTCTCGAATTTCATCAGTTGTTGCTTCTAGAAATTTTAGATTTTTTGGGTGGCAGCCATTTCTATATTTCGATGGATAAGTCAAACGTTCATAAAGTCAAGGGTTCTGCCTTTTGTTTGTGTTTC
CDS Sequence
- >AT2G33150.1
ATGGAGAAAGCGATCGAGAGACAACGCGTTCTTCTTGAGCATCTCCGACCTTCTTCTTCTTCTTCGCACAATTACGAGGCTTCTCTATCTGCTTCTGCTTGCTTGGCTGGGGACAGTGCTGCATATCAGAGGACCTCTCTCTATGGAGATGATGTTGTCATTGTCGCGGCACATAGGACTCCACTATGCAAGTCCAAACGTGGCAATTTCAAGGATACATATCCCGATGATTTGCTCGCACCTGTTTTGAGGGCATTGATAGAGAAGACGAATCTAAACCCAAGTGAAGTAGGTGACATTGTTGTGGGTACTGTTTTGGCACCTGGATCTCAGAGAGCCAGTGAATGCAGGATGGCTGCGTTCTATGCTGGTTTCCCTGAAACCGTGGCTGTCAGAACTGTGAATAGACAGTGCTCATCTGGGCTTCAGGCTGTTGCTGATGTAGCCGCTGCCATTAAAGCGGGATTTTATGACATTGGTATCGGGGCTGGTTTGGAGTCCATGACTACCAATCCAATGGCATGGGAAGGGTCAGTCAACCCAGCGGTGAAGAAGTTTGCACAAGCGCAGAATTGTCTTCTTCCTATGGGTGTTACGTCAGAAAATGTAGCACAACGCTTTGGTGTCTCAAGGCAGGAGCAAGATCAAGCTGCTGTTGACTCGCACAGAAAGGCAGCTGCTGCTACTGCTGCTGGTAAATTCAAGGATGAGATCATTCCTGTTAAGACCAAGCTTGTTGACCCGAAGACTGGTGATGAGAAACCCATTACAGTTTCTGTTGATGATGGTATCCGACCAACCACAACTCTTGCTTCTCTTGGGAAGCTGAAGCCAGTGTTTAAGAAGGATGGCACCACTACTGCTGGAAATTCCAGCCAAGTAAGTGATGGTGCAGGAGCGGTTCTCCTAATGAAGAGAAGTGTTGCAATGCAAAAAGGACTTCCCGTTCTTGGTGTATTCAGGACATTTGCTGCAGTTGGTGTTGACCCTGCAATCATGGGTATCGGTCCAGCAGTTGCCATTCCTGCTGCAGTTAAGGCGGCTGGTTTAGAACTTGATGACATCGACTTGTTTGAGATCAATGAGGCATTTGCATCTCAGTTTGTTTATTGCCGTAACAAATTGGGACTTGACCCAGAGAAAATCAATGTCAACGGAGGTGCAATGGCCATAGGCCATCCTTTGGGCGCTACAGGAGCGCGTTGTGTTGCTACATTGTTGCACGAGATGAAACGCCGTGGTAAAGACTGCCGTTTTGGAGTAGTGTCAATGTGCATTGGGACGGGGATGGGTGCAGCAGCTGTGTTTGAGAGAGGAGATGGAGTTGATGAGCTTCGCAACGCAAGGAAAGTTGAAGCGCAAGGTCTTTTGTCCAAGGACGCTCGCTAG
Protein Sequence
- >AT2G33150.1
MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR