Information report for AT2G30490
Gene Details
|
|
Functional Descriptions
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0008019 — leaf lamina base — base de la lámina de la hoja (Spanish, exact), 葉身基部 (Japanese, exact)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009025 — vascular leaf — foliage leaf (exact), hoja vascular (Spanish, exact), leaf, vascular (exact), vascular leaves (exact, plural), 維管束のある葉, または維管束植物の葉 (Japanese, exact), crozier (related), macrophyll (related), megaphyll (related), ascidia (narrow), ascidium (narrow), fiddlehead (narrow), frond (narrow), needle-like leaf (narrow), pitcher (narrow), pitcher blade (narrow), pitcher-blade (narrow), scale-like leaf (narrow), sterile frond (narrow), trophophyll (narrow)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009031 — sepal — sépalo (Spanish, exact), がく片 (Japanese, exact)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- CS66574 — altered phenylpropanoid metabolism; reductions in the levels of sinapoyl malate, flavonoids and lignin; dwarf; reduced apical dominance; swellings at inflorescence nodes caused by disordered growth of cortex cells
- CS66575 — altered phenylpropanoid metabolism; reductions in the levels of sinapoyl malate, flavonoids and lignin; dwarf; reduced apical dominance; swellings at inflorescence nodes caused by disordered growth of cortex cells
- CS66576 — altered phenylpropanoid metabolism; reductions in the levels of sinapoyl malate, flavonoids and lignin; plant development comparable to wild type
- cyp73a5-1 — Stunted plants. Reduced stature.
- ref3-1 — accumulate decreased levels of several different classes of phenylpropanoid end-products and exhibit reduced lignin deposition and altered lignin monomer content; accumulate a novel hydroxycinnamic ester, cinnamoylmalate, which is not found in the wild type; pleiotropic phenotypes includ dwarfism, male sterility, and the development of swellings at branch junctions.
Functional Keywords
Literature and News
- Arabidopsis cell wall proteome defined using multidimensional protein identification technology. DOI: 10.1002/pmic.200500046 ; PMID: 16287169
- Sucrose-specific induction of the anthocyanin biosynthetic pathway in Arabidopsis. DOI: 10.1104/pp.105.072579 ; PMID: 16384906
- Mapping the Arabidopsis organelle proteome. DOI: 10.1073/pnas.0506958103 ; PMID: 16618929
- Thaxtomin A affects CESA-complex density, expression of cell wall genes, cell wall composition, and causes ectopic lignification in Arabidopsis thaliana seedlings. DOI: 10.1093/jxb/ern344 ; PMID: 19269997
- Spatial association of photosynthesis and chemical defense in Arabidopsis thaliana following herbivory by Trichoplusia ni. DOI: 10.1111/j.1399-3054.2009.01265.x ; PMID: 19656330
- Mutations in the cinnamate 4-hydroxylase gene impact metabolism, growth and development in Arabidopsis. DOI: 10.1111/j.1365-313X.2009.03996.x ; PMID: 19682296
- Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana. DOI: 10.1073/pnas.0911635107 ; PMID: 20351290
- Engineering traditional monolignols out of lignin by concomitant up-regulation of F5H1 and down-regulation of COMT in Arabidopsis. DOI: 10.1111/j.1365-313X.2010.04353.x ; PMID: 20822504
- PhMYB4 fine-tunes the floral volatile signature of Petunia x hybrida through PhC4H. DOI: 10.1093/jxb/erq342 ; PMID: 21068208
- A systems biology view of responses to lignin biosynthesis perturbations in Arabidopsis. DOI: 10.1105/tpc.112.102574 ; PMID: 23012438
- Protein-protein and protein-membrane associations in the lignin pathway. DOI: 10.1105/tpc.112.102566 ; PMID: 23175744
- Engineering secondary cell wall deposition in plants. DOI: 10.1111/pbi.12016 ; PMID: 23140549
- Identification of quantitative trait loci controlling fibre length and lignin content in Arabidopsis thaliana stems. DOI: 10.1093/jxb/ers319 ; PMID: 23136168
- A gene-fusion approach to enabling plant cytochromes p450 for biocatalysis. DOI: 10.1002/cbic.201200572 ; PMID: 23129550
- De novo production of the flavonoid naringenin in engineered Saccharomyces cerevisiae. DOI: 10.1186/1475-2859-11-155 ; PMID: 23216753
- Root exudation of phytochemicals in Arabidopsis follows specific patterns that are developmentally programmed and correlate with soil microbial functions. DOI: 10.1371/journal.pone.0055731 ; PMID: 23383346
- Acyl-lipid metabolism. DOI: 10.1199/tab.0161 ; PMID: 23505340
- Caffeoyl shikimate esterase (CSE) is an enzyme in the lignin biosynthetic pathway in Arabidopsis. DOI: 10.1126/science.1241602 ; PMID: 23950498
- The Origin and Biosynthesis of the Benzenoid Moiety of Ubiquinone (Coenzyme Q) in Arabidopsis. DOI: 10.1105/tpc.114.125807 ; PMID: 24838974
- Mutation of the inducible ARABIDOPSIS THALIANA CYTOCHROME P450 REDUCTASE2 alters lignin composition and improves saccharification. DOI: 10.1104/pp.114.245548 ; PMID: 25315601
- Exogenous adenosine 5'-phosphoramidate behaves as a signal molecule in plants; it augments metabolism of phenylpropanoids and salicylic acid in Arabidopsis thaliana seedlings. DOI: 10.1016/j.plaphy.2015.05.013 ; PMID: 26079287
- Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. DOI: 10.1111/tpj.13008 ; PMID: 26332741
- The Allelochemical MDCA Inhibits Lignification and Affects Auxin Homeostasis. DOI: 10.1104/pp.15.01972 ; PMID: 27506238
- LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. DOI: 10.1104/pp.17.00160 ; PMID: 28483877
- Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation. DOI: 10.1007/s10265-017-0979-4 ; PMID: 28921082
- Stacking of a low-lignin trait with an increased guaiacyl and 5-hydroxyguaiacyl unit trait leads to additive and synergistic effects on saccharification efficiency in Arabidopsis thaliana. DOI: 10.1186/s13068-018-1257-y ; PMID: 30250509
- The Peroxidative Cleavage of Kaempferol Contributes to the Biosynthesis of the Benzenoid Moiety of Ubiquinone in Plants. DOI: 10.1105/tpc.18.00688 ; PMID: 30429224
- Gene Duplication Leads to Altered Membrane Topology of a Cytochrome P450 Enzyme in Seed Plants. DOI: 10.1093/molbev/msx160 ; PMID: 28505373
- Cytochrome b (5) Is an Obligate Electron Shuttle Protein for Syringyl Lignin Biosynthesis in Arabidopsis. DOI: 10.1105/tpc.18.00778 ; PMID: 30962392
- trans-Cinnamic acid-induced leaf expansion involves an auxin-independent component. DOI: 10.1080/19420889.2019.1605814 ; PMID: 31143367
- Correlations between lignin content and structural robustness in plants revealed by X-ray ptychography. DOI: 10.1038/s41598-020-63093-6 ; PMID: 32265529
- Identification of enzymatic genes with the potential to reduce biomass recalcitrance through lignin manipulation in Arabidopsis. DOI: 10.1186/s13068-020-01736-6 ; PMID: 32514309
- The Arabidopsis R2R3 MYB Transcription Factor MYB15 Is a Key Regulator of Lignin Biosynthesis in Effector-Triggered Immunity. DOI: 10.3389/fpls.2020.583153 ; PMID: 33042196
- Spatio-temporal control of phenylpropanoid biosynthesis by inducible complementation of a cinnamate 4-hydroxylase mutant. DOI: 10.1093/jxb/erab055 ; PMID: 33585900
- Seedling developmental defects upon blocking CINNAMATE-4-HYDROXYLASE are caused by perturbations in auxin transport. DOI: 10.1111/nph.17349 ; PMID: 33728703
- MYB3 plays an important role in lignin and anthocyanin biosynthesis under salt stress condition in Arabidopsis. DOI: 10.1007/s00299-022-02878-7 ; PMID: 35562569
- Transcript and metabolite network perturbations in lignin biosynthetic mutants of Arabidopsis. DOI: 10.1093/plphys/kiac344 ; PMID: 35880844
- Alternative splicing of Arabidopsis G6PD5 recruits NADPH-producing OPPP reactions to the endoplasmic reticulum. DOI: 10.3389/fpls.2022.909624 ; PMID: 36119606
- An R2R3-MYB FtMYB11 from Tartary buckwheat has contrasting effects on abiotic tolerance in Arabidopsis. DOI: 10.1016/j.jplph.2022.153842 ; PMID: 36434991
- NMR characterization of lignins in Arabidopsis altered in the activity of ferulate 5-hydroxylase. DOI: 10.1073/pnas.96.22.12328 ; PMID: 10535921
- Lignin monomer composition is determined by the expression of a cytochrome P450-dependent monooxygenase in Arabidopsis. DOI: 10.1073/pnas.95.12.6619 ; PMID: 9618461
- Two isoforms of NADPH:cytochrome P450 reductase in Arabidopsis thaliana. Gene structure, heterologous expression in insect cells, and differential regulation. DOI: 10.1104/pp.116.1.357 ; PMID: 9449848
- Cloning, yeast expression, and characterization of the coupling of two distantly related Arabidopsis thaliana NADPH-cytochrome P450 reductases with P450 CYP73A5. DOI: 10.1074/jbc.272.31.19176 ; PMID: 9235908
- Isolation of a cDNA and a genomic clone encoding cinnamate 4-hydroxylase from Arabidopsis and its expression manner in planta. DOI: 10.1104/pp.113.3.755 ; PMID: 9085571
- Cinnamate-4-hydroxylase expression in Arabidopsis. Regulation in response to development and the environment. DOI: 10.1104/pp.113.3.729 ; PMID: 9085570
- Ferulate-5-hydroxylase from Arabidopsis thaliana defines a new family of cytochrome P450-dependent monooxygenases. DOI: 10.1073/pnas.93.14.6869 ; PMID: 8692910
- Metabolic engineering of the phenylpropanoid pathway in Saccharomyces cerevisiae. DOI: 10.1128/AEM.71.6.2962-2969.2005 ; PMID: 15932991
- Arabidopsis cell wall proteome defined using multidimensional protein identification technology. DOI: 10.1002/pmic.200500046 ; PMID: 16287169
- Mapping the Arabidopsis organelle proteome. DOI: 10.1073/pnas.0506958103 ; PMID: 16618929
- A proteomics dissection of Arabidopsis thaliana vacuoles isolated from cell culture. DOI: 10.1074/mcp.M600250-MCP200 ; PMID: 17151019
- Quantitative phosphoproteomics of early elicitor signaling in Arabidopsis. DOI: 10.1074/mcp.M600429-MCP200 ; PMID: 17317660
- Molecular cloning of two genes encoding cinnamate 4-hydroxylase (C4H) from oilseed rape (Brassica napus). DOI: 10.5483/bmbrep.2007.40.2.247 ; PMID: 17394776
- Membrane proteomic analysis of Arabidopsis thaliana using alternative solubilization techniques. DOI: 10.1021/pr060525b ; PMID: 17432890
- A high content in lipid-modified peripheral proteins and integral receptor kinases features in the arabidopsis plasma membrane proteome. DOI: 10.1074/mcp.M700099-MCP200 ; PMID: 17644812
Gene Resources
- UniProt: B1GV49
- EMBL: AM887631, AM887632
- AlphaFoldDB: B1GV49
- EnsemblPlants: AT2G30490.1
- Gramene: AT2G30490.1
- KEGG: ath:AT2G30490
- Orthologous matrix: DPRAYWQ
- ExpressionAtlas: AT2G30490
- InterPro: IPR001128, IPR002401, IPR017972
- PANTHER: PTHR47948, PTHR47948:SF4
- SUPFAM: SSF48264
- PROSITE: PS00086
- Gene3D: 1.10.630.10
- SWISS-MODEL: B1GV49
- Conserved Domain Database: cd11074
Homologs
- Brassica napus BnaTT7.A10
- Citrullus lanatus Cla97C01G016310
- Gossypium hirsutum Ms5, Ms6, Ms5
- Oryza sativa OsC3H1, EP, OsCYP71D8L, OsCYP84A, OsCYP75B4;CYP75B4
- Triticum aestivum TaCYP81D2
Sequences
cDNA Sequence
- >AT2G30490.1
CCTACCTTCACCAAACACTTTTACATACACTTTGTGGTCTTTCTTTACCTACCACCATCAACAACAACACCAAGCCCCACTCACACACACGCAATCACGTTAAATTTAACGCCGTTTATTATCTCATCATTCACCAACTCCCACGTACCTAACGCCGTTTACCTTTTGCCGTTGGTCCTCATTTCTCAAACCAACCAAACCTCTCCCTCTTATAAAATCCTCTCTCCCTTCTTTATTTCTTCCTCAGCAGCTTCTTCTGCTTTCAATTACTCTCGCCGACGATTTTCTCACCGGAAAAAAACAATATCATTGCGGATACACAAACTATAATGGACCTCCTCTTGCTGGAGAAGTCTTTAATCGCCGTCTTCGTGGCGGTGATTCTCGCCACGGTGATTTCAAAGCTCCGCGGCAAGAAATTGAAGCTACCTCCAGGTCCTATACCAATTCCGATCTTCGGAAACTGGCTTCAAGTCGGAGATGATCTCAACCACCGTAATCTCGTCGATTACGCTAAGAAATTCGGCGATCTCTTCCTCCTCCGTATGGGTCAGCGAAACCTAGTCGTCGTCTCCTCACCGGATCTAACAAAGGAAGTGCTCCTCACTCAAGGCGTTGAGTTTGGATCCAGAACGAGAAACGTCGTGTTCGACATTTTCACCGGGAAAGGTCAAGATATGGTGTTCACTGTTTACGGCGAGCATTGGAGGAAGATGAGAAGAATCATGACGGTTCCTTTCTTCACCAACAAAGTTGTTCAACAGAATCGTGAAGGTTGGGAGTTTGAAGCAGCTAGTGTTGTTGAAGATGTTAAGAAGAATCCAGATTCTGCTACGAAAGGAATCGTGTTGAGGAAACGTTTGCAATTGATGATGTATAACAATATGTTCCGTATCATGTTCGATAGAAGATTTGAGAGTGAGGATGATCCTCTTTTCCTTAGGCTTAAGGCTTTGAATGGTGAGAGAAGTCGATTAGCTCAGAGCTTTGAGTATAACTATGGAGATTTCATTCCTATCCTTAGACCATTCCTCAGAGGCTATTTGAAGATTTGTCAAGATGTGAAAGATCGAAGAATCGCTCTTTTCAAGAAGTACTTTGTTGATGAGAGGAAGCAAATTGCGAGTTCTAAGCCTACAGGTAGTGAAGGATTGAAATGTGCCATTGATCACATCCTTGAAGCTGAGCAGAAGGGAGAAATCAACGAGGACAATGTTCTTTACATCGTCGAGAACATCAATGTCGCCGCGATTGAGACAACATTGTGGTCTATCGAGTGGGGAATTGCAGAGCTAGTGAACCATCCTGAAATCCAGAGTAAGCTAAGGAACGAACTCGACACAGTTCTTGGACCGGGTGTGCAAGTCACCGAGCCTGATCTTCACAAACTTCCATACCTTCAAGCTGTGGTTAAGGAGACTCTTCGTCTGAGAATGGCGATTCCTCTCCTCGTGCCTCACATGAACCTCCATGATGCGAAGCTCGCTGGCTACGATATCCCAGCAGAAAGCAAAATCCTTGTTAATGCTTGGTGGCTAGCAAACAACCCCAACAGCTGGAAGAAGCCTGAAGAGTTTAGACCAGAGAGGTTCTTTGAAGAAGAATCGCACGTGGAAGCTAACGGTAATGACTTCAGGTATGTGCCATTTGGTGTTGGACGTCGAAGCTGTCCCGGGATTATATTGGCATTGCCTATTTTGGGGATCACCATTGGTAGGATGGTCCAGAACTTCGAGCTTCTTCCTCCTCCAGGACAGTCTAAAGTGGATACTAGTGAGAAAGGTGGACAATTCAGCTTGCACATCCTTAACCACTCCATAATCGTTATGAAACCAAGGAACTGTTAAACTTTCTGCACAAAAAAAAGGATGAAGATGACTTTATAAATGTTTGTGAAATCTGTTGAAATATTCCCTTGTTTTGCTTTTGTGAGATGTTTTTGTGTAAAATGTCTTTAAATGGTTCGTTCTACGATTGCAATAATAATTAGTGGTGCTCATTGTTTTGGATGGATCAATGTTATACTTATATCATTTGAAAATCTCATGATTGTTGGACTTGGACCATAGTTGTTAATTTGAAG
CDS Sequence
- >AT2G30490.1
ATGGACCTCCTCTTGCTGGAGAAGTCTTTAATCGCCGTCTTCGTGGCGGTGATTCTCGCCACGGTGATTTCAAAGCTCCGCGGCAAGAAATTGAAGCTACCTCCAGGTCCTATACCAATTCCGATCTTCGGAAACTGGCTTCAAGTCGGAGATGATCTCAACCACCGTAATCTCGTCGATTACGCTAAGAAATTCGGCGATCTCTTCCTCCTCCGTATGGGTCAGCGAAACCTAGTCGTCGTCTCCTCACCGGATCTAACAAAGGAAGTGCTCCTCACTCAAGGCGTTGAGTTTGGATCCAGAACGAGAAACGTCGTGTTCGACATTTTCACCGGGAAAGGTCAAGATATGGTGTTCACTGTTTACGGCGAGCATTGGAGGAAGATGAGAAGAATCATGACGGTTCCTTTCTTCACCAACAAAGTTGTTCAACAGAATCGTGAAGGTTGGGAGTTTGAAGCAGCTAGTGTTGTTGAAGATGTTAAGAAGAATCCAGATTCTGCTACGAAAGGAATCGTGTTGAGGAAACGTTTGCAATTGATGATGTATAACAATATGTTCCGTATCATGTTCGATAGAAGATTTGAGAGTGAGGATGATCCTCTTTTCCTTAGGCTTAAGGCTTTGAATGGTGAGAGAAGTCGATTAGCTCAGAGCTTTGAGTATAACTATGGAGATTTCATTCCTATCCTTAGACCATTCCTCAGAGGCTATTTGAAGATTTGTCAAGATGTGAAAGATCGAAGAATCGCTCTTTTCAAGAAGTACTTTGTTGATGAGAGGAAGCAAATTGCGAGTTCTAAGCCTACAGGTAGTGAAGGATTGAAATGTGCCATTGATCACATCCTTGAAGCTGAGCAGAAGGGAGAAATCAACGAGGACAATGTTCTTTACATCGTCGAGAACATCAATGTCGCCGCGATTGAGACAACATTGTGGTCTATCGAGTGGGGAATTGCAGAGCTAGTGAACCATCCTGAAATCCAGAGTAAGCTAAGGAACGAACTCGACACAGTTCTTGGACCGGGTGTGCAAGTCACCGAGCCTGATCTTCACAAACTTCCATACCTTCAAGCTGTGGTTAAGGAGACTCTTCGTCTGAGAATGGCGATTCCTCTCCTCGTGCCTCACATGAACCTCCATGATGCGAAGCTCGCTGGCTACGATATCCCAGCAGAAAGCAAAATCCTTGTTAATGCTTGGTGGCTAGCAAACAACCCCAACAGCTGGAAGAAGCCTGAAGAGTTTAGACCAGAGAGGTTCTTTGAAGAAGAATCGCACGTGGAAGCTAACGGTAATGACTTCAGGTATGTGCCATTTGGTGTTGGACGTCGAAGCTGTCCCGGGATTATATTGGCATTGCCTATTTTGGGGATCACCATTGGTAGGATGGTCCAGAACTTCGAGCTTCTTCCTCCTCCAGGACAGTCTAAAGTGGATACTAGTGAGAAAGGTGGACAATTCAGCTTGCACATCCTTAACCACTCCATAATCGTTATGAAACCAAGGAACTGTTAA
Protein Sequence
- >AT2G30490.1
MDLLLLEKSLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHRNLVDYAKKFGDLFLLRMGQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQNREGWEFEAASVVEDVKKNPDSATKGIVLRKRLQLMMYNNMFRIMFDRRFESEDDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICQDVKDRRIALFKKYFVDERKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVMKPRNC