Information report for AT2G30420
Gene Details
|
|
Functional Descriptions
- PO:0000282 — trichome — tricoma (Spanish, exact), 毛茸、糸状体、毛 (Japanese, exact), seta (related), setae (related), capilli (narrow), capillus (narrow), cilia (narrow), cilium (narrow), glochid (narrow), glochidia (narrow), glochidium (narrow), hair (narrow), lepides (narrow), lepis (narrow), non-secretory trichome (narrow), scale (narrow), squama (narrow), squamae (narrow), squamella (narrow), squamellae (narrow), squamule (narrow), barb trichome (broad), bristle (broad)
- PO:0002000 — stomatal complex — complejo estomático (Spanish, exact), stomatal apparatus (exact), stomate (exact), 気孔装置 (Japanese, exact), stoma (broad), stomata (broad)
Functional Keywords
Literature and News
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Characterization, expression and phylogenetic study of R2R3-MYB genes in orchid. DOI: 10.1023/a:1023050110077 ; PMID: 12777054
- Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: and shoot-specific genes. DOI: 10.1111/j.1365-313X.2004.02051.x ; PMID: 15078338
- The ENHANCER OF TRY AND CPC1 gene acts redundantly with TRIPTYCHON and CAPRICE in trichome and root hair cell patterning in Arabidopsis. DOI: 10.1016/j.ydbio.2003.12.037 ; PMID: 15063185
- Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. DOI: 10.1111/j.1365-313X.2004.02183.x ; PMID: 15361138
- The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. DOI: 10.1007/s11103-005-2910-y ; PMID: 16463103
- Highly specific gene silencing by artificial microRNAs in Arabidopsis. DOI: 10.1105/tpc.105.039834 ; PMID: 16531494
- ENHANCER of TRY and CPC 2 (ETC2) reveals redundancy in the region-specific control of trichome development of Arabidopsis. DOI: 10.1007/s11103-004-0893-8 ; PMID: 15604688
- Patterning of Arabidopsis epidermal cells: epigenetic factors regulate the complex epidermal cell fate pathway. DOI: 10.1016/j.tplants.2006.10.001 ; PMID: 17088095
- Distinct and overlapping roles of single-repeat MYB genes in root epidermal patterning. DOI: 10.1016/j.ydbio.2007.09.001 ; PMID: 17931617
- MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. DOI: 10.1111/j.1365-313X.2008.03564.x ; PMID: 18532978
- Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. DOI: 10.1104/pp.108.126979 ; PMID: 18805951
- Functional diversity of R3 single-repeat genes in trichome development. DOI: 10.1242/dev.021733 ; PMID: 19336467
- A single amino acid replacement in ETC2 shapes trichome patterning in natural Arabidopsis populations. DOI: 10.1016/j.cub.2009.08.057 ; PMID: 19818620
- Genome-wide association study of 107 phenotypes in Arabidopsis thaliana inbred lines. DOI: 10.1038/nature08800 ; PMID: 20336072
- Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis. DOI: 10.3390/ijms13033478 ; PMID: 22489163
- Control of plant trichome and root-hair development by a tomato (Solanum lycopersicum) R3 MYB transcription factor. DOI: 10.1371/journal.pone.0054019 ; PMID: 23326563
- Tomato (Solanum lycopersicum) homologs of TRIPTYCHON (SlTRY) and GLABRA3 (SlGL3) are involved in anthocyanin accumulation. DOI: 10.4161/psb.24575 ; PMID: 23603939
- Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. DOI: 10.1186/1471-2229-13-229 ; PMID: 24377444
- Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. DOI: 10.1080/15592324.2015.1089372 ; PMID: 26339713
- Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. DOI: 10.3389/fpls.2015.00955 ; PMID: 26579186
- CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. DOI: 10.1016/j.plantsci.2015.10.015 ; PMID: 26706076
- Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. DOI: 10.1242/dev.149542 ; PMID: 28676568
- Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots. DOI: 10.1371/journal.pone.0205522 ; PMID: 30308079
- Effect of phosphate starvation on CAPRICE homolog gene expression in the root of Arabidopsis. DOI: 10.5511/plantbiotechnology.20.0226a ; PMID: 33088199
- Differential environmental and genomic architectures shape the natural diversity for trichome patterning and morphology in different Arabidopsis organs. DOI: 10.1111/pce.14308 ; PMID: 35289421
- Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. DOI: 10.1126/science.290.5499.2105 ; PMID: 11118137
- Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. DOI: 10.1093/molbev/msj051 ; PMID: 16280546
- The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. DOI: 10.1007/s11103-005-2910-y ; PMID: 16463103
- Distinct and overlapping roles of single-repeat MYB genes in root epidermal patterning. DOI: 10.1016/j.ydbio.2007.09.001 ; PMID: 17931617
- Arabidopsis CAPRICE-LIKE MYB 3 (CPL3) controls endoreduplication and flowering development in addition to trichome and root hair formation. DOI: 10.1242/dev.017947 ; PMID: 18305006
- Comprehensive analysis of single-repeat R3 MYB proteins in epidermal cell patterning and their transcriptional regulation in Arabidopsis. DOI: 10.1186/1471-2229-8-81 ; PMID: 18644155
Gene Resources
Homologs
- Brassica napus GSBRNA2T00142148001, GSBRNA2T00024517001, GSBRNA2T00009408001, GSBRNA2T00009407001
- Brassica oleracea XP_013626295.1
- Brassica rapa XP_009132732.1, XP_009119863.1
- Raphanus raphanistrum RrC3941_p2, RrC23313_p1
Sequences
cDNA Sequence
- >AT2G30420.1
ATCGAACGTATCACGAAATTATGTTTTGACGTATTCGATCGGGATATATAAAAACAAAAATGTGAATTATAAATTTAGGAATATATACGTAGAAATTCCAATAAAAAATAAATCACCTATCTCTCTCTCTCTCTTTTTATATAACTATTTTTTTCCCTCACATCTTTTCTATATCTTGCATTCTCCAAACTCTACATTTTCAGTTTCTCTGTAAATTTATCTAATATTCTTCTATTTTCCAGTAGTTATGGATAATACCAACCGTCTTCGTCTTCGTCGCGGTCCCAGTCTTAGGCAAACTAAGTTCACTCGATCCCGATATGACTCTGAAGAAGTGAGTAGCATCGAATGGGAGTTTATCAGTATGACCGAACAAGAAGAAGATCTCATCTCTCGAATGTACAGACTTGTCGGTAATAGGTGGGATTTAATAGCAGGAAGAGTCGTAGGAAGAAAGGCAAATGAGATTGAGAGATACTGGATTATGAGAAACTCTGACTATTTTTCTCACAAACGACGACGTCTTAATAATTCTCCCTTTTTTTCTACTTCTCCTCTTAATCTCCAAGAAAATCTAAAATTGTAAAGAAATCAAAATAAAAGCTTTCAATCATAAAAGTAGAACAAATCTTGAATGTCTTCTCATCATATAAATGGTTCAGAAATTGTTGAATCT
CDS Sequence
- >AT2G30420.1
ATGGATAATACCAACCGTCTTCGTCTTCGTCGCGGTCCCAGTCTTAGGCAAACTAAGTTCACTCGATCCCGATATGACTCTGAAGAAGTGAGTAGCATCGAATGGGAGTTTATCAGTATGACCGAACAAGAAGAAGATCTCATCTCTCGAATGTACAGACTTGTCGGTAATAGGTGGGATTTAATAGCAGGAAGAGTCGTAGGAAGAAAGGCAAATGAGATTGAGAGATACTGGATTATGAGAAACTCTGACTATTTTTCTCACAAACGACGACGTCTTAATAATTCTCCCTTTTTTTCTACTTCTCCTCTTAATCTCCAAGAAAATCTAAAATTGTAA
Protein Sequence
- >AT2G30420.1
MDNTNRLRLRRGPSLRQTKFTRSRYDSEEVSSIEWEFISMTEQEEDLISRMYRLVGNRWDLIAGRVVGRKANEIERYWIMRNSDYFSHKRRRLNNSPFFSTSPLNLQENLKL