Information report for AT2G26670
Gene Details
|
|
Functional Descriptions
- PO:0009006 — shoot system — sistema de epiblasto (epiblastema) (Spanish, exact), シュート系、苗条系 (Japanese, exact), Poaceae crown (related), shoot (related), thalli (related), thallus (related), tree crown (narrow)
- PO:0009009 — plant embryo — embrión (Spanish, exact), 植物胚 (Japanese, exact), germ (related), embryo (broad)
- PO:0009029 — stamen — estambre (Spanish, exact), 雄蕊 (Japanese, exact), Poaceae stamen (narrow), Zea stamen (narrow)
- PO:0009052 — inflorescence flower pedicel — 小花柄 (Japanese, related), pedicelo (Spanish, broad)
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020038 — petiole — pecíolo (Spanish, exact), 葉柄 (Japanese, exact)
- PO:0020100 — hypocotyl — hipocótile (Spanish, exact), 胚軸 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0000014 — rosette leaf — hoja en roseta (Spanish, exact), ロゼット葉 (Japanese, exact)
- PO:0000037 — shoot axis apex — ápice del epiblasto (epiblastema) (Spanish, exact), シュート頂、茎頂 (Japanese, exact)
- PO:0009001 — fruit — frucht (exact, German), fruto (exact, Spanish), 果実 (exact, Japanese), coenocarp (narrow), syncarp (narrow), aggregate fruit (broad), compound fruit (broad), dehiscent fruit (broad), diaspore (broad), indehiscent fruit (broad), multiple fruit (broad), propagule (broad)
- PO:0009005 — root — raíz (Spanish, exact), radices (exact, plural), radix (exact), 根 (Japanese, exact), aerial root (narrow), climbing root (narrow)
- PO:0009046 — flower — flor (Spanish, exact), 花 (Japanese, exact), floret (related), Asteraceae floret (narrow), basal flower (narrow), double flower (narrow), hermaphrodite flower (narrow), monoclinous flower (narrow), perfect flower (narrow)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
Functional Keywords
- shoot system , plant embryo , stamen , inflorescence flower pedicel , cotyledon , petiole , hypocotyl , leaf apex , collective leaf structure , pollen , cauline leaf , rosette leaf , shoot axis apex , fruit , root , flower , stem , cotyledon , hypocotyl
Literature and News
- Phytobilin biosynthesis: the Synechocystis sp. PCC 6803 heme oxygenase-encoding ho1 gene complements a phytochrome-deficient Arabidopsis thalianna hy1 mutant. DOI: 10.1023/a:1006489129449 ; PMID: 10949378
- Microinjection of heme oxygenase genes rescues phytochrome-chromophore-deficient mutants of the moss Ceratodon purpureus. DOI: 10.1007/s004250050041 ; PMID: 10787045
- Modification of distinct aspects of photomorphogenesis via targeted expression of mammalian biliverdin reductase in transgenic Arabidopsis plants. DOI: 10.1104/pp.121.2.629 ; PMID: 10517855
- Blue light-directed destabilization of the pea Lhcb1*4 transcript depends on sequences within the 5' untranslated region. DOI: 10.1105/tpc.11.8.1579 ; PMID: 10449589
- The Arabidopsis thaliana HY1 locus, required for phytochrome-chromophore biosynthesis, encodes a protein related to heme oxygenases. DOI: 10.1073/pnas.96.11.6541 ; PMID: 10339624
- The Arabidopsis photomorphogenic mutant hy1 is deficient in phytochrome chromophore biosynthesis as a result of a mutation in a plastid heme oxygenase. DOI: 10.1105/tpc.11.3.335 ; PMID: 10072395
- and phytochrome regulation of nuclear gene expression. DOI: 10.1104/pp.118.3.803 ; PMID: 9808724
- UV-B-induced photomorphogenesis in Arabidopsis thaliana. DOI: 10.1046/j.1365-313x.1998.00246.x ; PMID: 9778848
- Extragenic suppressors of the Arabidopsis det1 mutant identify elements of flowering-time and light-response regulatory pathways. DOI: 10.1093/genetics/145.4.1125 ; PMID: 9093863
- Photo and hormonal control of meristem identity in the Arabidopsis flower mutants apetala2 and apetala1. DOI: 10.1105/tpc.9.1.37 ; PMID: 9014363
- Flowers into shoots: photo and hormonal control of a meristem identity switch in Arabidopsis. DOI: 10.1073/pnas.93.24.13831 ; PMID: 8943021
- Mutations of Arabidopsis in potential transduction and response components of the phototropic signaling pathway. DOI: 10.1104/pp.112.1.291 ; PMID: 8819327
- The ELONGATED gene of Arabidopsis acts independently of light and gibberellins in the control of elongation growth. DOI: 10.1046/j.1365-313x.1996.09030305.x ; PMID: 8919908
- Transgene-mediated auxin overproduction in Arabidopsis: hypocotyl elongation phenotype and interactions with the hy6-1 hypocotyl elongation and axr1 auxin-resistant mutants. DOI: 10.1007/BF00020881 ; PMID: 7766890
- Arabidopsis COP8, COP10, and COP11 genes are involved in repression of photomorphogenic development in darkness. DOI: 10.1105/tpc.6.5.629 ; PMID: 8038603
- Regulatory hierarchy of photomorphogenic loci: allele-specific and light-dependent interaction between the HY5 and COP1 loci. DOI: 10.1105/tpc.6.5.613 ; PMID: 8038602
- Signal transduction mutants of Arabidopsis uncouple nuclear CAB and RBCS gene expression from chloroplast development. DOI: 10.1016/0092-8674(93)90459-4 ; PMID: 7690685
- Interactions between hy1 and gun mutants of Arabidopsis, and their implications for plastid/nuclear signalling. DOI: 10.1046/j.1365-313x.2000.00936.x ; PMID: 11135121
- Arabidopsis genomes uncoupled 5 (GUN5) mutant reveals the involvement of Mg-chelatase H subunit in plastid-to-nucleus signal transduction. DOI: 10.1073/pnas.98.4.2053 ; PMID: 11172074
- The heme-oxygenase family required for phytochrome chromophore biosynthesis is necessary for proper photomorphogenesis in higher plants. DOI: 10.1104/pp.126.2.656 ; PMID: 11402195
- Phytochrome-Deficient hy1 and hy2 Long Hypocotyl Mutants of Arabidopsis Are Defective in Phytochrome Chromophore Biosynthesis. DOI: 10.1105/tpc.3.11.1177 ; PMID: 12324588
- Light-Stimulated Cotyledon Expansion in Arabidopsis Seedlings (The Role of Phytochrome B). DOI: 10.1104/pp.104.3.1027 ; PMID: 12232145
- The Effects of Cytokinin and Light on Hypocotyl Elongation in Arabidopsis Seedlings Are Independent and Additive. DOI: 10.1104/pp.108.4.1423 ; PMID: 12228552
- Making light of it: the role of plant haem oxygenases in phytochrome chromophore synthesis. DOI: NA ; PMID: 12196146
- Light-signalling pathways leading to the co-ordinated expression of HEMA1 and Lhcb during chloroplast development in Arabidopsis thaliana. DOI: 10.1046/j.1365-313x.2002.01443.x ; PMID: 12445126
- Expression and biochemical properties of a ferredoxin-dependent heme oxygenase required for phytochrome chromophore synthesis. DOI: 10.1104/pp.008128 ; PMID: 12481078
- Opposing roles of phytochrome A and phytochrome B in early cryptochrome-mediated growth inhibition. DOI: 10.1046/j.1365-313x.2001.01157.x ; PMID: 11722775
- Multiple heme oxygenase family members contribute to the biosynthesis of the phytochrome chromophore in Arabidopsis. DOI: 10.1104/pp.105.074211 ; PMID: 16428602
- Phytochrome chromophore deficiency leads to overproduction of jasmonic acid and elevated expression of jasmonate-responsive genes in Arabidopsis. DOI: 10.1093/pcp/pcm076 ; PMID: 17567636
- Distinct light-initiated gene expression and cell cycle programs in the shoot apex and cotyledons of Arabidopsis. DOI: 10.1105/tpc.107.057075 ; PMID: 18424613
- Characterization of the haem oxygenase protein family in Arabidopsis thaliana reveals a diversity of functions. DOI: 10.1042/BJ20090775 ; PMID: 19860740
- Ethylene suppression of sugar-induced anthocyanin pigmentation in Arabidopsis. DOI: 10.1104/pp.110.161869 ; PMID: 20876338
- Enzymatic ring opening of an iron corrole by plant-type heme oxygenases: unexpected substrate and protein selectivities. DOI: 10.1021/bi1014369 ; PMID: 20979354
- Identification of nuclear genes encoding chloroplast-localized proteins required for embryo development in Arabidopsis. DOI: 10.1104/pp.110.168120 ; PMID: 21139083
- Evidence of Arabidopsis salt acclimation induced by up-regulation of HY1 and the regulatory role of RbohD-derived reactive oxygen species synthesis. DOI: 10.1111/j.1365-313X.2011.04488.x ; PMID: 21205037
- Isolation and characterization of a heme oxygenase-1 gene from Chinese cabbage. DOI: 10.1007/s12033-011-9407-5 ; PMID: 21505948
- BnHO1, a haem oxygenase-1 gene from Brassica napus, is required for salinity and osmotic stress-induced lateral root formation. DOI: 10.1093/jxb/err190 ; PMID: 21673093
- Microbial volatile-induced accumulation of exceptionally high levels of starch in Arabidopsis leaves is a process involving NTRC and starch synthase classes III and IV. DOI: 10.1094/MPMI-05-11-0112 ; PMID: 21649509
- Heme oxygenases from Arabidopsis thaliana reveal different mechanisms of carbon monoxide binding. DOI: 10.1016/j.saa.2011.12.011 ; PMID: 22204880
- Functional interconnections of HY1 with MYC2 and HY5 in Arabidopsis seedling development. DOI: 10.1186/1471-2229-12-37 ; PMID: 22424472
- Mutation of Arabidopsis HY1 causes UV-C hypersensitivity by impairing carotenoid and flavonoid biosynthesis and the down-regulation of antioxidant defence. DOI: 10.1093/jxb/ers078 ; PMID: 22419743
- Molecular nature of mutations induced by high-LET irradiation with argon and carbon ions in Arabidopsis thaliana. DOI: 10.1016/j.mrfmmm.2012.04.010 ; PMID: 22579628
- HY1 genetically interacts with GBF1 and regulates the activity of the Z-box containing promoters in light signaling pathways in Arabidopsis thaliana. DOI: 10.1016/j.mod.2012.06.004 ; PMID: 22766018
- Disrupting the bimolecular binding of the haem-binding protein 5 (AtHBP5) to haem oxygenase 1 (HY1) leads to oxidative stress in Arabidopsis. DOI: 10.1093/jxb/ers242 ; PMID: 22991161
- Evidence for a Contribution of ALA Synthesis to Plastid-To-Nucleus Signaling. DOI: 10.3389/fpls.2012.00236 ; PMID: 23112801
- AtHO1 is involved in iron homeostasis in an NO-dependent manner. DOI: 10.1093/pcp/pct063 ; PMID: 23620481
- Roles of NIA/NR/NOA1-dependent nitric oxide production and HY1 expression in the modulation of Arabidopsis salt tolerance. DOI: 10.1093/jxb/ert149 ; PMID: 23744476
- Arabidopsis HY1 confers cadmium tolerance by decreasing nitric oxide production and improving iron homeostasis. DOI: 10.1093/mp/sst122 ; PMID: 23974911
- Spectral-dependence of light-inhibited hypocotyl elongation in photomorphogenic mutants of Arabidopsis: evidence for a UV-A photosensor. DOI: 10.1007/BF00198946 ; PMID: 24178206
- Immunochemically detectable phytochrome is present at normal levels but is photochemically nonfunctional in the hy 1 and hy 2 long hypocotyl mutants of Arabidopsis. DOI: 10.1007/BF00017582 ; PMID: 24272903
- Interaction between HY1 and H2O2 in auxin-induced lateral root formation in Arabidopsis. DOI: 10.1007/s11103-013-0168-3 ; PMID: 24366686
- Arabidopsis HY1-Modulated Stomatal Movement: An Integrative Hub Is Functionally Associated with ABI4 in Dehydration-Induced ABA Responsiveness. DOI: 10.1104/pp.15.01550 ; PMID: 26704641
- Ectopic over-expression of BoHO1, a cabbage heme oxygenase gene, improved salt tolerance in Arabidopsis: A case study on proteomic analysis. DOI: 10.1016/j.jplph.2016.02.019 ; PMID: 27016873
- Expression of recombinant full-length plant phytochromes assembled with phytochromobilin in Pichia pastoris. DOI: 10.1016/j.febslet.2014.05.050 ; PMID: 24911206
- Transcriptional Regulation of Tetrapyrrole Biosynthesis in Arabidopsis thaliana. DOI: 10.3389/fpls.2016.01811 ; PMID: 27990150
- SHB1/HY1 Alleviates Excess Boron Stress by Increasing BOR4 Expression Level and Maintaining Boron Homeostasis in Arabidopsis Roots. DOI: 10.3389/fpls.2017.00790 ; PMID: 28559907
- Carbon monoxide signal regulates light-initiated seed germination by suppressing SOM expression. DOI: 10.1016/j.plantsci.2018.04.009 ; PMID: 29807609
- Trithorax-group protein ATX5 mediates the glucose response via impacting the HY1-ABI4 signaling module. DOI: 10.1007/s11103-018-0791-0 ; PMID: 30406469
- Light Activates Brassinosteroid Biosynthesis to Promote Hook Opening and Petiole Development in Arabidopsis thaliana. DOI: 10.1093/pcp/pcaa053 ; PMID: 32333772
- Enzymological and structural characterization of Arabidopsis thaliana heme oxygenase-1. DOI: 10.1002/2211-5463.13453 ; PMID: 35689519
- Carbon monoxide promotes stomatal initiation by regulating the expression of two EPF genes in Arabidopsis cotyledons. DOI: 10.3389/fpls.2022.1029703 ; PMID: 36438138
- Shade represses photosynthetic genes by disrupting the DNA binding of GOLDEN2-LIKE1. DOI: 10.1093/plphys/kiad029 ; PMID: 36702576
- Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. DOI: 10.1093/molbev/msj051 ; PMID: 16280546
- Sorting signals, N-terminal modifications and abundance of the chloroplast proteome. DOI: 10.1371/journal.pone.0001994 ; PMID: 18431481
- Analysis of protein complexes in Arabidopsis leaves using size exclusion chromatography and label-free protein correlation profiling. DOI: 10.1016/j.jprot.2017.06.004 ; PMID: 28627464
- Sorting signals, N-terminal modifications and abundance of the chloroplast proteome. DOI: 10.1371/journal.pone.0001994 ; PMID: 18431481
Gene Resources
- UniProt: A0A178VP48
- EMBL: CACRSJ010000105, CACSHJ010000088, LUHQ01000002
- AlphaFoldDB: A0A178VP48
- EnsemblPlants: AT2G26670.1
- Gramene: AT2G26670.1
- KEGG: ath:AT2G26670
- Orthologous matrix: PPEFICH
- ExpressionAtlas: AT2G26670
- InterPro: IPR002051, IPR016053, IPR016084
- PANTHER: PTHR35703, PTHR35703:SF2
- SUPFAM: SSF48613
- Gene3D: 1.20.910.10
- OrthoDB: A0A178VP48
- SWISS-MODEL: A0A178VP48
- Conserved Domain Database: cd19165
Homologs
- Brassica napus BnaA09G0420000ZS, BnaC05G0249900ZS, BnaA07G0150900ZS, BnaC07G0217000ZS
- Brassica oleracea Bo5g057380, Bo7g065110
- Brassica rapa Bra040771, Bra012054
- Citrullus lanatus Cla97C06G120310
- Gossypium hirsutum Gohir.D06G054525
- Juglans regia Jr01_29830
- Manihot esculenta MANES_14G132400
- Prunus persica PRUPE_7G243300
- Rosa chinensis RchiOBHm_Chr2g0088381
Sequences
cDNA Sequence
- >AT2G26670.1
CTCCTACAGACATTCAGACATGTGCAACACTCAACGCACTGTCGATATTACATAGACCCGAAATAAAAGCTCCTTGTCCAAAAACTTCATTCACCCTCTCATCGTTATCTTCATTTGGAAACAACTAAACAATATTCTGTTTTATTAATATTTTCGCCTATTTAAAAATTCAATTAGAATAGTGTATCCCTCTTCTCTATTCCTTCAAGCCAACTAAAACTACATTGCGTGACTTCTTCTGTAACCATTTTTCTATTCCGATCAAACCATGGCGTATTTAGCTCCGATTTCTTCATCCTTATCCATATTCAAGAATCCCCAACTCTCAAGATTCCAATTTTCTTCTTCCTCACCGAACCCACTTTTCCTTCGACCTAGGATTCAGATTCTGAGTATGACCATGAACAAGTCGCCGTCTTTAGTGGTGGTTGCGGCTACTACTGCGGCAGAGAAGCAGAAGAAGAGGTATCCTGGAGAATCAAAGGGTTTTGTGGAGGAGATGAGGTTTGTGGCTATGAGACTTCATACTAAAGATCAAGCTAAGGAAGGTGAGAAAGAGACTAAATCTATTGAGGAACGTCCTGTTGCTAAATGGGAACCTACTGTTGAAGGTTACTTGAGGTTTCTTGTGGATAGTAAATTGGTTTATGATACTCTTGAACTGATTATTCAAGACTCCAATTTCCCAACTTATGCCGAGTTCAAGAACACGGGGCTGGAAAGAGCGGAGAAATTATCCACGGATTTGGAGTGGTTCAAGGAACAAGGTTACGAGATTCCAGAACCAACAGCTCCTGGTAAAACATATTCTCAATATTTAAAGGAATTAGCAGAGAAGGATCCTCAAGCATTCATTTGTCACTTCTACAACATCTACTTTGCTCATAGTGCTGGTGGACGAATGATTGGCAGAAAGGTGGCAGAGCGGATACTCGATAATAAAGAACTCGAGTTCTACAAATGGGACGGCGAACTTTCTCAATTGTTGCAGAACGTTAGGGAGAAACTGAACAAGGTTGCAGAGGAGTGGACTAGAGAAGAAAAGAATCATTGTTTGGAAGAGACTGAGAAATCGTTCAAGTATTCTGGTGAGATACTTCGTCTCATATTGTCCTGATTTGGTGCGCAGTGTCTCTAGATATCTCAATACGTCTTGTGGCAACTAAAATGATGCACATTGTTTATATTCCTGTATTATATTAATCATCTTCTACATGTATTAAACTCTTCTTTGCTTCAAAGCTGTTACTAAGTTCAAGGTTCAAATTAATAACTTTTCTGCCGTTTTATAGCTCAAATACAAGTTCAATGATCAGTGTACATCTGATATAGCCAGAGGACTGACTCTTCTATATATGTTGGATAGAATTCTGTGAACTTTTGACATCTTTATGGTTGGTCTATAAATGGTGATGA - >AT2G26670.2
CTCCTACAGACATTCAGACATGTGCAACACTCAACGCACTGTCGATATTACATAGACCCGAAATAAAAGCTCCTTGTCCAAAAACTTCATTCACCCTCTCATCGTTATCTTCATTTGGAAACAACTAAACAATATTCTGTTTTATTAATATTTTCGCCTATTTAAAAATTCAATTAGAATAGTGTATCCCTCTTCTCTATTCCTTCAAGCCAACTAAAACTACATTGCGTGACTTCTTCTGTAACCATTTTTCTATTCCGATCAAACCATGGCGTATTTAGCTCCGATTTCTTCATCCTTATCCATATTCAAGAATCCCCAACTCTCAAGATTCCAATTTTCTTCTTCCTCACCGAACCCACTTTTCCTTCGACCTAGGATTCAGATTCTGAGTATGACCATGAACAAGTCGCCGTCTTTAGTGGTGGTTGCGGCTACTACTGCGGCAGAGAAGCAGAAGAAGAGGTATCCTGGAGAATCAAAGGGTTTTGTGGAGGAGATGAGGTTTGTGGCTATGAGACTTCATACTAAAGATCAAGCTAAGGAAGGTGAGAAAGAGACTAAATCTATTGAGGAACGTCCTGTTGCTAAATGGGAACCTACTGTTGAAGGTTACTTGAGGTTTCTTGTGGATAGTAAATTGGTTTATGATACTCTTGAACTGATTATTCAAGACTCCAATTTCCCAACTTATGCCGAGTTCAAGAACACGGGGCTGGAAAGAGCGGAGAAATTATCCACGGATTTGGAGTGGTTCAAGGAACAAGGTTACGAGATTCCAGAACCAACAGCTCCTGGTAAAACATATTCTCAATATTTAAAGGAATTAGCAGAGAAGGATCCTCAAGCATTCATTTGTCACTTCTACAACATCTACTTTGCTCATAGTGCTGGTGGACGAATGATTGGCAGAAAGGTGGCAGAGCGGATACTCGATAATAAAGAACTCGAGTTCTACAAATGGGACGGCGAACTTTCTCAATTGTTGCAGAACGTTAGGGAGAAACTGAACAAGGTTGCAGAGGAGTGGACTAGAGAAGAAAAGAATCATTGTTTGGAAGAGACTGAGAAATCGTTCAAGTATTCTGGTGAGATACTTCGTCTCATATTGTCCTGATTTGGTGCGCAGTGTCTCTAGATATCTCAATACGTCTTGTGGCAACTAAAATGATGCACATTGTTTATATTCCTGTATTATATTAATCATCTTCTACATGTATTAAACTCTTCTTTGCTTCAAAGCTGTTACTAAGTTCAAGGTTCAAATTAATAACTTTTCTGCCGTTTTATAGCTCAAATACAAGTTCAATGATCAGTGTACATCTGATATAGCCAGAGGACTGACTCTTCTATATATGTTGGATAGAATTCTGTGAACTTTTGACATCTTTATGGTTGGTCTATAAATGGTGATGA
CDS Sequence
- >AT2G26670.1
ATGGCGTATTTAGCTCCGATTTCTTCATCCTTATCCATATTCAAGAATCCCCAACTCTCAAGATTCCAATTTTCTTCTTCCTCACCGAACCCACTTTTCCTTCGACCTAGGATTCAGATTCTGAGTATGACCATGAACAAGTCGCCGTCTTTAGTGGTGGTTGCGGCTACTACTGCGGCAGAGAAGCAGAAGAAGAGGTATCCTGGAGAATCAAAGGGTTTTGTGGAGGAGATGAGGTTTGTGGCTATGAGACTTCATACTAAAGATCAAGCTAAGGAAGGTGAGAAAGAGACTAAATCTATTGAGGAACGTCCTGTTGCTAAATGGGAACCTACTGTTGAAGGTTACTTGAGGTTTCTTGTGGATAGTAAATTGGTTTATGATACTCTTGAACTGATTATTCAAGACTCCAATTTCCCAACTTATGCCGAGTTCAAGAACACGGGGCTGGAAAGAGCGGAGAAATTATCCACGGATTTGGAGTGGTTCAAGGAACAAGGTTACGAGATTCCAGAACCAACAGCTCCTGGTAAAACATATTCTCAATATTTAAAGGAATTAGCAGAGAAGGATCCTCAAGCATTCATTTGTCACTTCTACAACATCTACTTTGCTCATAGTGCTGGTGGACGAATGATTGGCAGAAAGGTGGCAGAGCGGATACTCGATAATAAAGAACTCGAGTTCTACAAATGGGACGGCGAACTTTCTCAATTGTTGCAGAACGTTAGGGAGAAACTGAACAAGGTTGCAGAGGAGTGGACTAGAGAAGAAAAGAATCATTGTTTGGAAGAGACTGAGAAATCGTTCAAGTATTCTGGTGAGATACTTCGTCTCATATTGTCCTGA - >AT2G26670.2
ATGGCGTATTTAGCTCCGATTTCTTCATCCTTATCCATATTCAAGAATCCCCAACTCTCAAGATTCCAATTTTCTTCTTCCTCACCGAACCCACTTTTCCTTCGACCTAGGATTCAGATTCTGAGTATGACCATGAACAAGTCGCCGTCTTTAGTGGTGGTTGCGGCTACTACTGCGGCAGAGAAGCAGAAGAAGAGGTATCCTGGAGAATCAAAGGGTTTTGTGGAGGAGATGAGGTTTGTGGCTATGAGACTTCATACTAAAGATCAAGCTAAGGAAGGTGAGAAAGAGACTAAATCTATTGAGGAACGTCCTGTTGCTAAATGGGAACCTACTGTTGAAGGTTACTTGAGGTTTCTTGTGGATAGTAAATTGGTTTATGATACTCTTGAACTGATTATTCAAGACTCCAATTTCCCAACTTATGCCGAGTTCAAGAACACGGGGCTGGAAAGAGCGGAGAAATTATCCACGGATTTGGAGTGGTTCAAGGAACAAGGTTACGAGATTCCAGAACCAACAGCTCCTGGTAAAACATATTCTCAATATTTAAAGGAATTAGCAGAGAAGGATCCTCAAGCATTCATTTGTCACTTCTACAACATCTACTTTGCTCATAGTGCTGGTGGACGAATGATTGGCAGAAAGGTGGCAGAGCGGATACTCGATAATAAAGAACTCGAGTTCTACAAATGGGACGGCGAACTTTCTCAATTGTTGCAGAACGTTAGGGAGAAACTGAACAAGGTTGCAGAGGAGTGGACTAGAGAAGAAAAGAATCATTGTTTGGAAGAGACTGAGAAATCGTTCAAGTATTCTGGTGAGATACTTCGTCTCATATTGTCCTGA
Protein Sequence
- >AT2G26670.1
MAYLAPISSSLSIFKNPQLSRFQFSSSSPNPLFLRPRIQILSMTMNKSPSLVVVAATTAAEKQKKRYPGESKGFVEEMRFVAMRLHTKDQAKEGEKETKSIEERPVAKWEPTVEGYLRFLVDSKLVYDTLELIIQDSNFPTYAEFKNTGLERAEKLSTDLEWFKEQGYEIPEPTAPGKTYSQYLKELAEKDPQAFICHFYNIYFAHSAGGRMIGRKVAERILDNKELEFYKWDGELSQLLQNVREKLNKVAEEWTREEKNHCLEETEKSFKYSGEILRLILS - >AT2G26670.2
MAYLAPISSSLSIFKNPQLSRFQFSSSSPNPLFLRPRIQILSMTMNKSPSLVVVAATTAAEKQKKRYPGESKGFVEEMRFVAMRLHTKDQAKEGEKETKSIEERPVAKWEPTVEGYLRFLVDSKLVYDTLELIIQDSNFPTYAEFKNTGLERAEKLSTDLEWFKEQGYEIPEPTAPGKTYSQYLKELAEKDPQAFICHFYNIYFAHSAGGRMIGRKVAERILDNKELEFYKWDGELSQLLQNVREKLNKVAEEWTREEKNHCLEETEKSFKYSGEILRLILS