Gene Details:
- Gene ID: AT2G26020
- Gene Symbol: PDF1.2b
- Gene Name: plant defensin 1.2b
- Description: plant defensin 1.2b;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0020030 — cotyledon — cotiledón (Spanish, exact), seed leaf (exact), 子葉 (Japanese, exact)
- PO:0020137 — leaf apex — ápice de la hoja (Spanish, exact), 葉先 (Japanese, exact), leaf lamina apex (narrow), phyllid apex (narrow)
- PO:0025022 — collective leaf structure — estructura colectiva de hoja (Spanish, exact), leaf series (exact), 葉が集まった構造 (Japanese, exact), leaf whorl (narrow), rosette (narrow), cycle (broad), verticil (broad)
Function-related keywords:
Literature:
- Plant defensins. DOI: 10.1007/s00425-002-0902-6 ; PMID: 12447532
- Loss of a callose synthase results in salicylic acid-dependent disease resistance. DOI: 10.1126/science.1086716 ; PMID: 12920300
- Loss of TIP1;1 aquaporin in Arabidopsis leads to cell and plant death. DOI: 10.1111/j.1365-313X.2004.02265.x ; PMID: 15584951
- Genome organization of more than 300 defensin-like genes in Arabidopsis. DOI: 10.1104/pp.105.060079 ; PMID: 15955924
- Microarray analysis reveals vegetative molecular phenotypes of Arabidopsis flowering-time mutants. DOI: 10.1093/pcp/pci128 ; PMID: 15908439
- Zinc-dependent global transcriptional control, transcriptional deregulation, and higher gene copy number for genes in metal homeostasis of the hyperaccumulator Arabidopsis halleri. DOI: 10.1104/pp.105.076232 ; PMID: 16844841
- and jasmonic acid/ethylene-dependent responses via EDS1 and PAD4. DOI: 10.1111/j.1365-313X.2006.02806.x ; PMID: 16813576
- A comprehensive structure-function analysis of Arabidopsis SNI1 defines essential regions and transcriptional repressor activity. DOI: 10.1105/tpc.105.039677 ; PMID: 16766691
- Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens. DOI: 10.1104/pp.106.082073 ; PMID: 16998091
- Suppression by ABA of salicylic acid and lignin accumulation and the expression of multiple genes, in Arabidopsis infected with Pseudomonas syringae pv. tomato. DOI: 10.1007/s10142-006-0041-4 ; PMID: 17149585
- Simultaneous interaction of Arabidopsis thaliana with Bradyrhizobium Sp. strain ORS278 and Pseudomonas syringae pv. tomato DC3000 leads to complex transcriptome changes. DOI: 10.1094/MPMI-21-2-0244 ; PMID: 18184068
- Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. DOI: 10.1104/pp.108.121038 ; PMID: 18650403
- Plant pathogenesis-related (PR) proteins: a focus on PR peptides. DOI: 10.1016/j.plaphy.2008.06.011 ; PMID: 18674922
- Chloroplast signaling and LESION SIMULATING DISEASE1 regulate crosstalk between light acclimation and immunity in Arabidopsis. DOI: 10.1105/tpc.108.059618 ; PMID: 18790826
- Transcriptional profiling of pea ABR17 mediated changes in gene expression in Arabidopsis thaliana. DOI: 10.1186/1471-2229-8-91 ; PMID: 18783601
- Arabidopsis ENHANCED DISEASE RESISTANCE 1 is required for pathogen-induced expression of plant defensins in nonhost resistance, and acts through interference of MYC2-mediated repressor function. DOI: 10.1111/j.1365-313X.2011.04651.x ; PMID: 21605210
- ETHYLENE RESPONSE FACTOR 96 positively regulates Arabidopsis resistance to and ethylene-responsive defence genes. DOI: 10.1111/pce.12583 ; PMID: 26038230
- Loss of the Arabidopsis Protein Kinases ANPs Affects Root Cell Wall Composition, and Triggers the Cell Wall Damage Syndrome. DOI: 10.3389/fpls.2017.02234 ; PMID: 29403509
- Exploring expression patterns of PR-1, PR-2, PR-3, and PR-12 like genes in Arabidopsis thaliana upon Alternaria brassicae inoculation. DOI: 10.1007/s13205-018-1259-2 ; PMID: 29719772
- Brassinosteroids Antagonize Jasmonate-Activated Plant Defense Responses through BRI1-EMS-SUPPRESSOR1 (BES1). DOI: 10.1104/pp.19.01220 ; PMID: 31776183
- Genome organization of more than 300 defensin-like genes in Arabidopsis. DOI: 10.1104/pp.105.060079 ; PMID: 15955924
- Caterpillar saliva interferes with induced Arabidopsis thaliana defence responses via the systemic acquired resistance pathway. DOI: 10.1093/jxb/ern108 ; PMID: 18487634
- The AP2/ERF domain transcription factor ORA59 integrates jasmonic acid and ethylene signals in plant defense. DOI: 10.1104/pp.108.117523 ; PMID: 18467450
- Plant pathogenesis-related (PR) proteins: a focus on PR peptides. DOI: 10.1016/j.plaphy.2008.06.011 ; PMID: 18674922
Sequences:
cDNA Sequence
- >AT2G26020.1
GTTTAATTTGTGGGGTACAATTAGCTCGTTATTGTACCATGCACAAGTAGAAAATAAACTCACCATCATTTCATTATAAATAAAGGTTGATCTCTTAAGCTTATTTCTTCACACAACACATACATACATACATTGAAAACAAAGTAGTAATAATCATCATGGCTAAGTTTGCTTCCATCATCACCTTTATCTACGCTGCTCTTGTTCTCTTTGCAGCTTTTGAAGTACCAACAATGGTGGAAGCACAGAAGTTGTGCGAGAAGCCAAGTGGTACTTGGTCAGGAGTTTGCGGAAACAGCAATGCATGCAAGAATCAGTGCATTAACCTTGAAGGAGCAAAACATGGATCTTGCAACTATGTCTTCCCAGCTCACAAGTGTATCTGTTACGTCCCATGTTAATTTACCAATTTTCTTTGGTTCTTTATCGATGTGTATTTATATTTTTAAAAATAAGTCTGTGTCATTCTATGAGTGACTTAAGGCATGCATGTTTATGTTTTAATGTTTGGTGTGACTTTTCTATAAAAATATAAAATTTAAGTACGACGTAGGACTTTTTTCTTGTCCATATTTGGTTACAACACGACCATTATACATACTATTTTTT
CDS Sequence
- >AT2G26020.1
ATGGCTAAGTTTGCTTCCATCATCACCTTTATCTACGCTGCTCTTGTTCTCTTTGCAGCTTTTGAAGTACCAACAATGGTGGAAGCACAGAAGTTGTGCGAGAAGCCAAGTGGTACTTGGTCAGGAGTTTGCGGAAACAGCAATGCATGCAAGAATCAGTGCATTAACCTTGAAGGAGCAAAACATGGATCTTGCAACTATGTCTTCCCAGCTCACAAGTGTATCTGTTACGTCCCATGTTAA
Protein Sequence
- >AT2G26020.1
MAKFASIITFIYAALVLFAAFEVPTMVEAQKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC