Gene Details:
- Gene ID: AT1G06680
- Gene Symbol: OE23, OEE2, PSBP-1, PSII-P
- Gene Name: OXYGEN EVOLVING COMPLEX SUBUNIT 23 KDA, OXYGEN-EVOLVING ENHANCER PROTEIN 2, photosystem II subunit P-1, PHOTOSYSTEM II SUBUNIT P
- Description: photosystem II subunit P-1;(source:Araport11)
- TAIR Accession: locus:2033087
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0000230 — inflorescence meristem — meristema de la inflorescencia (Spanish, exact), 花序分裂組織 (Japanese, exact)
- PO:0009010 — seed — semilla (Spanish, exact), 種子 (Japanese, exact), pyrene (narrow), diaspore (broad)
- PO:0009030 — carpel — carpelo (Spanish, exact), 心皮 (Japanese, exact), Poaceae carpel (narrow), Zea carpel (narrow), pistil (broad)
- PO:0009032 — petal — pétalo (Spanish, exact), 花弁 (Japanese, exact)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0005020 — vascular bundle — haz vascular (Spanish, exact), vein (exact), 維管束 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
Gene Ontology:
- GO:0009507 — located in — chloroplast
- GO:0008266 — enables — poly(U) RNA binding
- GO:0009579 — located in — thylakoid
- GO:0009535 — located in — chloroplast thylakoid membrane
- GO:0009543 — located in — chloroplast thylakoid lumen
- GO:0009534 — located in — chloroplast thylakoid
- GO:0009570 — located in — chloroplast stroma
- GO:0019898 — located in — extrinsic component of membrane
- GO:0009941 — located in — chloroplast envelope
- GO:0009654 — part of — photosystem II oxygen evolving complex
- GO:0003729 — enables — mRNA binding
- GO:1901149 — enables — salicylic acid binding
- GO:0005509 — enables — calcium ion binding
- GO:0005576 — located in — extracellular region
- GO:0048046 — located in — apoplast
- GO:0031977 — located in — thylakoid lumen
- GO:0019684 — acts upstream of or within — photosynthesis, light reaction
Function-related keywords:
- cauline leaf , inflorescence meristem , seed , carpel , petal , stem , pollen , vascular bundle , guard cell
Literature:
- Natural variation at Strubbelig Receptor Kinase 3 drives immune-triggered incompatibilities between Arabidopsis thaliana accessions. DOI: 10.1038/ng.704 ; PMID: 21037570
- Characterization of transcriptome remodeling during cambium formation identifies MOL1 and RUL1 as opposing regulators of secondary growth. DOI: 10.1371/journal.pgen.1001312 ; PMID: 21379334
- Structure-function analysis of STRUBBELIG, an Arabidopsis atypical receptor-like kinase involved in tissue morphogenesis. DOI: 10.1371/journal.pone.0019730 ; PMID: 21603601
- Characterization of temperature-sensitive mutants reveals a role for receptor-like kinase SCRAMBLED/STRUBBELIG in coordinating cell proliferation and differentiation during Arabidopsis leaf development. DOI: 10.1111/j.1365-313X.2012.05109.x ; PMID: 22805005
- QUIRKY interacts with STRUBBELIG and PAL OF QUIRKY to regulate cell growth anisotropy during Arabidopsis gynoecium development. DOI: 10.1242/dev.091868 ; PMID: 24173806
- Distinct signaling mechanisms in multiple developmental pathways by the SCRAMBLED receptor of Arabidopsis. DOI: 10.1104/pp.114.247288 ; PMID: 25136062
- The C2-domain protein QUIRKY and the receptor-like kinase STRUBBELIG localize to plasmodesmata and mediate tissue morphogenesis in Arabidopsis thaliana. DOI: 10.1242/dev.113878 ; PMID: 25256344
- TRIPTYCHON, not CAPRICE, participates in feedback regulation of SCM expression in the Arabidopsis root epidermis. DOI: 10.4161/15592324.2014.973815 ; PMID: 25482776
- TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. DOI: 10.1080/15592324.2015.1103407 ; PMID: 26451798
- HAPLESS13-Mediated Trafficking of STRUBBELIG Is Critical for Ovule Development in Arabidopsis. DOI: 10.1371/journal.pgen.1006269 ; PMID: 27541731
- The cell wall-localized atypical β-1,3 glucanase ZERZAUST controls tissue morphogenesis in Arabidopsis thaliana. DOI: 10.1242/dev.152231 ; PMID: 28507000
- Positioning of the SCRAMBLED receptor requires UDP-Glc:sterol glucosyltransferase 80B1 in Arabidopsis roots. DOI: 10.1038/s41598-017-05925-6 ; PMID: 28720840
- QUIRKY regulates root epidermal cell patterning through stabilizing SCRAMBLED to control CAPRICE movement in Arabidopsis. DOI: 10.1038/s41467-019-09715-8 ; PMID: 30988311
- The Arabidopsis receptor kinase STRUBBELIG undergoes clathrin-dependent endocytosis. DOI: 10.1093/jxb/erz190 ; PMID: 31107531
- The Arabidopsis receptor kinase STRUBBELIG regulates the response to cellulose deficiency. DOI: 10.1371/journal.pgen.1008433 ; PMID: 31961852
- Proper protein folding in the endoplasmic reticulum is required for attachment of a glycosylphosphatidylinositol anchor in plants. DOI: 10.1093/plphys/kiab181 ; PMID: 33930152
- Cell wall damage attenuates root hair patterning and tissue morphogenesis mediated by the receptor kinase STRUBBELIG. DOI: 10.1242/dev.199425 ; PMID: 34251020
- Ammonium and nitric oxide condition the establishment of Arabidopsis Ler/Kas-2 immune-related hybrid incompatibility. DOI: 10.1007/s00425-022-03990-4 ; PMID: 36087170
- KTN80 confers precision to microtubule severing by specific targeting of katanin complexes in plant cells. DOI: 10.15252/embj.201796823 ; PMID: 28978669
- Purification, cloning, and characterization of the CEL I nuclease. DOI: 10.1021/bi992376z ; PMID: 10736152
- Identification of BFN1, a bifunctional nuclease induced during leaf and stem senescence in Arabidopsis. DOI: 10.1104/pp.122.1.169 ; PMID: 10631260
- The NAC transcription factors NST1 and NST2 of Arabidopsis regulate secondary wall thickenings and are required for anther dehiscence. DOI: 10.1105/tpc.105.036004 ; PMID: 16214898
- Characterization of Arabidopsis thaliana mismatch specific endonucleases: application to mutation discovery by TILLING in pea. DOI: 10.1111/j.1365-313X.2007.03201.x ; PMID: 17651368
- The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis. DOI: 10.1105/tpc.107.053678 ; PMID: 17890373
- Mutation detection using ENDO1: application to disease diagnostics in humans and TILLING and Eco-TILLING in plants. DOI: 10.1186/1471-2199-9-42 ; PMID: 18433472
- Expression analysis of the BFN1 nuclease gene promoter during senescence, abscission, and programmed cell death-related processes. DOI: 10.1093/jxb/ern176 ; PMID: 18603613
- Nucleases in higher plants and their possible involvement in DNA degradation during leaf senescence. DOI: 10.1093/jxb/eru091 ; PMID: 24634485
- NAC Transcription Factors ANAC087 and ANAC046 Control Distinct Aspects of Programmed Cell Death in the Arabidopsis Columella and Lateral Root Cap. DOI: 10.1105/tpc.18.00293 ; PMID: 30099383
- Identification of key genes and transcription factors in ageing Arabidopsis papilla cells by transcriptome analysis. DOI: 10.1016/j.plaphy.2019.12.008 ; PMID: 31837555
- Calcium-Dependent Protein Kinase CPK1 Controls Cell Death by In Vivo Phosphorylation of Senescence Master Regulator ORE1. DOI: 10.1105/tpc.19.00810 ; PMID: 32111670
- Morphological and Physiological Framework Underlying Plant Longevity in Arabidopsis thaliana. DOI: 10.3389/fpls.2020.600726 ; PMID: 33224176
- ANAC087 transcription factor positively regulates age-dependent leaf senescence through modulating the expression of multiple target genes in Arabidopsis. DOI: 10.1111/jipb.13434 ; PMID: 36519581
- Repressive ZINC FINGER OF ARABIDOPSIS THALIANA proteins promote programmed cell death in the Arabidopsis columella root cap. DOI: 10.1093/plphys/kiad130 ; PMID: 36852889
- Enhanced tolerance to oxidative stress in transgenic Arabidopsis plants expressing proteins of unknown function. DOI: 10.1104/pp.108.124875 ; PMID: 18614705
- A systems model of vesicle trafficking in Arabidopsis pollen tubes. DOI: 10.1104/pp.109.148700 ; PMID: 19933386
- A systems model of exocytic vesicles in Arabidopsis pollen during its germination. DOI: 10.4161/psb.5.4.10911 ; PMID: 20118666
- Localization of Arabidopsis SYP125 syntaxin in the plasma membrane sub-apical and distal zones of growing pollen tubes. DOI: 10.4161/psb.6.5.14423 ; PMID: 21499026
- Nuclear membrane localization during pollen development and apex-focused polarity establishment of SYP124/125 during pollen germination in Arabidopsis thaliana. DOI: 10.1007/s00497-015-0265-3 ; PMID: 26111864
- Evolutionarily diverse SYP1 Qa-SNAREs jointly sustain pollen tube growth in Arabidopsis. DOI: 10.1111/tpj.13659 ; PMID: 28792633
- Steady-state and presteady-state kinetics of the H+/hexose cotransporter (STP1) from Arabidopsis thaliana expressed in Xenopus oocytes. DOI: S0021-9258(17)32008-2 ; PMID: 8051137
- Functional reconstitution of the solubilized Arabidopsis thaliana STP1 monosaccharide-H+ symporter in lipid vesicles and purification of the histidine tagged protein from transgenic Saccharomyces cerevisiae. DOI: 10.1046/j.1365-313x.1994.6020225.x ; PMID: 7920712
- The heterologous expression of H(+)-coupled transporters in Xenopus oocytes. DOI: NA ; PMID: 7597641
- Functional expression of a plant plasma membrane transporter in Xenopus oocytes. DOI: 10.1016/0014-5793(92)80431-f ; PMID: 1633849
- Primary structure, genomic organization and heterologous expression of a glucose transporter from Arabidopsis thaliana. DOI: 10.1002/j.1460-2075.1990.tb07500.x ; PMID: 2209537
- Monosaccharide/proton symporter AtSTP1 plays a major role in uptake and response of Arabidopsis seeds and seedlings to sugars. DOI: 10.1046/j.1365-313x.2000.00935.x ; PMID: 11135118
- Roles of cell-wall invertases and monosaccharide transporters in the growth and development of Arabidopsis. DOI: 10.1093/jxb/erg055 ; PMID: 12508063
- Diurnal and light-regulated expression of AtSTP1 in guard cells of Arabidopsis. DOI: 10.1104/pp.103.024240 ; PMID: 12972665
- Regulation of gene expression by photosynthetic signals triggered through modified CO2 availability. DOI: 10.1186/1471-2229-6-15 ; PMID: 16916444
Sequences:
cDNA Sequence
- >AT1G06680.2
ACTTAATCACACACAAGGAGAGAAGAGAGAAAGAGAGAAAGAGAGACAGAGATAATGGCGTACAGTGCGTGTTTCCTACACCAGAGCGCATTGGCTTCATCAGCCGCACGATCATCATCTTCCTCCTCATCCCAGCGTCACGTGTCGCTCTCCAAACCTGTTCAGATCATCTGTAAAGCTCAACAGTCTCATGAAGACGATAACTCCGCCGTCTCCCGCCGTCTTGCTCTCACTCTCCTCGTCGGCGCCGCTGCTGTTGGTTCCAAAGTATCTCCTGCTGATGCCGCCTACGGTGAAGCTGGTGCCAAACGTGTTTGGGAAGCCAAAGACGAACACAGACTTCTTGCCATACAATGGAGATGGGTTCAAAGTGCAGGTTCCAGCAAAATGGAACCCAAGCAAAGAGATTGAGTATCCAGGACAAGTCCTTAGGTTCGAAGACAACTTCGATGCTACTAGCAATCTCAATGTCATGGTCACTCCTACCGACAAGAAGTCCATCACTGATTACGGTTCTCCCGAAGAGTTCCTCTCTCAGGTTAATTACCTCCTAGGGAAACAAGCTTACTTCGGTGAGACTGCCTCTGAGGGAGGCTTTGACAACAATGCAGTGGCAACAGCAAACATTCTGGAGTCATCATCTCAGGAAGTTGGTGGGAAACCCTACTATTACTTGTCTGTGTTGACAAGAACGGCTGATGGAGACGAAGGTGGGAAGCATCAGCTGATCACAGCAACCGTGAATGGAGGGAAGCTTTACATCTGCAAAGCACAAGCTGGAGACAAGAGGTGGTTCAAGGGAGCCAGGAAATTTGTCGAGAGCGCAGCCACTTCTTTCAGTGTTGCTTGAGTGAAAGCAACACAACGTAACAATGCTCTGCTTGCTTTCTTCATTTGTCTCTTGTAAAAAATGGAAAATGAAACTGAGCTTTTGAGAACTATCAAGATGATGTTACCTTTTCGGCATCACTTGTGTACCTATGATAACAGACTCGTTTTCCAAGTTTTCTTAAAAAACAACTATATTCAATAGATATTTTCTCAAATTAATAAGATATTGACTCAGAAA - >AT1G06680.1
ACTTAATCACACACAAGGAGAGAAGAGAGAAAGAGAGAAAGAGAGACAGAGATAATGGCGTACAGTGCGTGTTTCCTACACCAGAGCGCATTGGCTTCATCAGCCGCACGATCATCATCTTCCTCCTCATCCCAGCGTCACGTGTCGCTCTCCAAACCTGTTCAGATCATCTGTAAAGCTCAACAGTCTCATGAAGACGATAACTCCGCCGTCTCCCGCCGTCTTGCTCTCACTCTCCTCGTCGGCGCCGCTGCTGTTGGTTCCAAAGTATCTCCTGCTGATGCCGCCTACGGTGAAGCTGGTGCCAAACGTGTTTGGGAAGCCAAAGACGAACACAGACTTCTTGCCATACAATGGAGATGGGTTCAAAGTGCAGGTTCCAGCAAAATGGAACCCAAGCAAAGAGATTGAGTATCCAGGACAAGTCCTTAGGTTCGAAGACAACTTCGATGCTACTAGCAATCTCAATGTCATGGTCACTCCTACCGACAAGAAGTCCATCACTGATTACGGTTCTCCCGAAGAGTTCCTCTCTCAGGTTAATTACCTCCTAGGGAAACAAGCTTACTTCGGTGAGACTGCCTCTGAGGGAGGCTTTGACAACAATGCAGTGGCAACAGCAAACATTCTGGAGTCATCATCTCAGGAAGTTGGTGGGAAACCCTACTATTACTTGTCTGTGTTGACAAGAACGGCTGATGGAGACGAAGGTGGGAAGCATCAGCTGATCACAGCAACCGTGAATGGAGGGAAGCTTTACATCTGCAAAGCACAAGCTGGAGACAAGAGGTGGTTCAAGGGAGCCAGGAAATTTGTCGAGAGCGCAGCCACTTCTTTCAGTGTTGCTTGAGTGAAAGCAACACAACGTAACAATGCTCTGCTTGCTTTCTTCATTTGTCTCTTGTAAAAAATGGAAAATGAAACTGAGCTTTTGAGAACTATCAAGATGATGTTACCTTTTCGGCATCACTTGTGTACCTATGATAACAGACTCGTTTTCCAAGTTTTCTTAAAAAACAACTATATTCAATAGATATTTTCTCAAATTAATAAGATATTGACTCAGAAA
CDS Sequence
- >AT1G06680.2
ATGAAGACGATAACTCCGCCGTCTCCCGCCGTCTTGCTCTCACTCTCCTCGTCGGCGCCGCTGCTGTTGGTTCCAAAGTATCTCCTGCTGATGCCGCCTACGGTGAAGCTGGTGCCAAACGTGTTTGGGAAGCCAAAGACGAACACAGACTTCTTGCCATACAATGGAGATGGGTTCAAAGTGCAGGTTCCAGCAAAATGGAACCCAAGCAAAGAGATTGAGTATCCAGGACAAGTCCTTAGGTTCGAAGACAACTTCGATGCTACTAGCAATCTCAATGTCATGGTCACTCCTACCGACAAGAAGTCCATCACTGATTACGGTTCTCCCGAAGAGTTCCTCTCTCAGGTTAATTACCTCCTAGGGAAACAAGCTTACTTCGGTGAGACTGCCTCTGAGGGAGGCTTTGACAACAATGCAGTGGCAACAGCAAACATTCTGGAGTCATCATCTCAGGAAGTTGGTGGGAAACCCTACTATTACTTGTCTGTGTTGACAAGAACGGCTGATGGAGACGAAGGTGGGAAGCATCAGCTGATCACAGCAACCGTGAATGGAGGGAAGCTTTACATCTGCAAAGCACAAGCTGGAGACAAGAGGTGGTTCAAGGGAGCCAGGAAATTTGTCGAGAGCGCAGCCACTTCTTTCAGTGTTGCTTGA - >AT1G06680.1
ATGAAGACGATAACTCCGCCGTCTCCCGCCGTCTTGCTCTCACTCTCCTCGTCGGCGCCGCTGCTGTTGGTTCCAAAGTATCTCCTGCTGATGCCGCCTACGGTGAAGCTGGTGCCAAACGTGTTTGGGAAGCCAAAGACGAACACAGACTTCTTGCCATACAATGGAGATGGGTTCAAAGTGCAGGTTCCAGCAAAATGGAACCCAAGCAAAGAGATTGAGTATCCAGGACAAGTCCTTAGGTTCGAAGACAACTTCGATGCTACTAGCAATCTCAATGTCATGGTCACTCCTACCGACAAGAAGTCCATCACTGATTACGGTTCTCCCGAAGAGTTCCTCTCTCAGGTTAATTACCTCCTAGGGAAACAAGCTTACTTCGGTGAGACTGCCTCTGAGGGAGGCTTTGACAACAATGCAGTGGCAACAGCAAACATTCTGGAGTCATCATCTCAGGAAGTTGGTGGGAAACCCTACTATTACTTGTCTGTGTTGACAAGAACGGCTGATGGAGACGAAGGTGGGAAGCATCAGCTGATCACAGCAACCGTGAATGGAGGGAAGCTTTACATCTGCAAAGCACAAGCTGGAGACAAGAGGTGGTTCAAGGGAGCCAGGAAATTTGTCGAGAGCGCAGCCACTTCTTTCAGTGTTGCTTGA
Protein Sequence
- >AT1G06680.2
MKTITPPSPAVLLSLSSSAPLLLVPKYLLLMPPTVKLVPNVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVESAATSFSVA - >AT1G06680.1
MKTITPPSPAVLLSLSSSAPLLLVPKYLLLMPPTVKLVPNVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVESAATSFSVA