Information report for AT1G06180
Gene Details
|
|
Functional Descriptions
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0009010 — seed — semilla (Spanish, exact), 種子 (Japanese, exact), pyrene (narrow), diaspore (broad)
- PO:0009030 — carpel — carpelo (Spanish, exact), 心皮 (Japanese, exact), Poaceae carpel (narrow), Zea carpel (narrow), pistil (broad)
- PO:0009032 — petal — pétalo (Spanish, exact), 花弁 (Japanese, exact)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
Functional Keywords
- cauline leaf , seed , carpel , petal , stem , pollen , guard cell
Literature and News
- The branched-chain amino acid transaminase gene family in Arabidopsis encodes plastid and mitochondrial proteins. DOI: 10.1104/pp.001602 ; PMID: 12068099
- Branched-chain aminotransferase4 is part of the chain elongation pathway in the biosynthesis of methionine-derived glucosinolates in Arabidopsis. DOI: 10.1105/tpc.105.039339 ; PMID: 17056707
- The metabolic response of heterotrophic Arabidopsis cells to oxidative stress. DOI: 10.1104/pp.106.090431 ; PMID: 17122072
- Metabolic and transcriptomic changes induced in Arabidopsis by the rhizobacterium Pseudomonas fluorescens SS101. DOI: 10.1104/pp.112.207324 ; PMID: 23073694
- Genome-wide analysis of branched-chain amino acid levels in Arabidopsis seeds. DOI: 10.1105/tpc.113.119370 ; PMID: 24368787
- The mitochondrial branched-chain aminotransferase (AtBCAT-1) is capable to initiate degradation of leucine, isoleucine and valine in almost all tissues in Arabidopsis thaliana. DOI: 10.1007/s11103-004-7533-1 ; PMID: 15821880
- Monitoring expression profiles of Arabidopsis gene expression during rehydration process after dehydration using ca 7000 full-length cDNA microarray. DOI: 10.1046/j.1365-313x.2003.01774.x ; PMID: 12795706
- Global transcription profiling reveals multiple sugar signal transduction mechanisms in Arabidopsis. DOI: 10.1105/tpc.104.022616 ; PMID: 15273295
- Cloning and functional characterization of Arabidopsis thaliana D-amino acid aminotransferase–D-aspartate behavior during germination. DOI: 10.1111/j.1742-4658.2008.06279.x ; PMID: 18318836
- A role for BELLRINGER in cell wall development is supported by loss-of-function phenotypes. DOI: 10.1186/1471-2229-12-212 ; PMID: 23148846
- Abscisic acid-regulated protein degradation causes osmotic stress-induced accumulation of branched-chain amino acids in Arabidopsis thaliana. DOI: 10.1007/s00425-017-2727-3 ; PMID: 28668976
- OSCA1 mediates osmotic-stress-evoked Ca2+ increases vital for osmosensing in Arabidopsis. DOI: 10.1038/nature13593 ; PMID: 25162526
- The SebHLH transcription factor mediates trans-activation of the SeFAD2 gene and G-box elements. DOI: 10.1007/s11103-007-9165-8 ; PMID: 17420955
- Epigenetic regulation of miR396 expression by SWR1-C and the effect of miR396 on leaf growth and developmental phase transition in Arabidopsis. DOI: 10.1093/jxb/erz285 ; PMID: 31198943
- ECA3, a Golgi-localized P2A-type ATPase, plays a crucial role in manganese nutrition in Arabidopsis. DOI: 10.1104/pp.107.110817 ; PMID: 18024560
- The trans-Golgi-localized protein BICAT3 regulates manganese allocation and matrix polysaccharide biosynthesis. DOI: 10.1093/plphys/kiac387 ; PMID: 35993897
- Dissecting the relative contribution of ECA3 and group 8/9 cation diffusion facilitators to manganese homeostasis in Arabidopsis thaliana. DOI: 10.1002/pld3.495 ; PMID: 37228331
- The AtNFXL1 gene encodes a NF-X1 type zinc finger protein required for growth under salt stress. DOI: 10.1016/j.febslet.2006.07.079 ; PMID: 16905136
- AtNFXL1, an Arabidopsis homologue of the human transcription factor NF-X1, functions as a negative regulator of the trichothecene phytotoxin-induced defense response. DOI: 10.1111/j.1365-313X.2007.03353.x ; PMID: 18069941
- The AtNFXL1 gene functions as a signaling component of the type A trichothecene-dependent response. DOI: 10.4161/psb.6291 ; PMID: 19704430
- Structure and putative function of NFX1-like proteins in plants. DOI: 10.1111/j.1438-8677.2009.00303.x ; PMID: 20522174
Gene Resources
- UniProt: A0A178W702
- EMBL: CACRSJ010000104, LUHQ01000001
- AlphaFoldDB: A0A178W702
- EnsemblPlants: AT1G06180.1
- Gramene: AT1G06180.1
- KEGG: ath:AT1G06180
- Orthologous matrix: WAYIARM
- ExpressionAtlas: AT1G06180
- InterPro: IPR001005, IPR009057, IPR015495
- PANTHER: PTHR10641, PTHR10641:SF1383
- SUPFAM: SSF46689
- PROSITE: PS50090, PS51294
- Gene3D: 1.10.10.60
- SWISS-MODEL: A0A178W702
- Conserved Domain Database: cd00167
Homologs
- Brassica napus GSBRNA2T00087995001, GSBRNA2T00031997001, GSBRNA2T00010344001, GSBRNA2T00020543001
- Brassica oleracea XP_013583909.1, XP_013634924.1, XP_013634894.1
- Brassica rapa XP_009119084.1, XP_009144594.1, XP_009141138.1
- Raphanus raphanistrum RrC378_p7
Sequences
cDNA Sequence
- >AT1G06180.1
TATAAATATAGTAACACACTTAGCCATCGTACACTTACTAGTTACTTCCAACATTTGGCTTCCTTTGCTTTCACGAATAGAAACCTTAGCTTCTTCCATTTCTTCTTTCTCTCCTCGTTTAAATTAGTTTTTGACAAGGAAGAAAAAGATGGGGAGAAGACCATGCTGTGAGAAGATAGGATTGAAGAAAGGGCCATGGAGTGCTGAAGAAGATCGAATCTTGATCAATTATATTAGTCTCCATGGCCATCCCAATTGGAGAGCTCTCCCTAAACTAGCCGGGCTACTTCGGTGCGGAAAAAGTTGCAGGCTTCGTTGGATTAATTATTTGAGACCAGACATCAAACGTGGCAATTTCACTCCTCATGAAGAAGATACTATCATCAGCTTACATCAACTCTTAGGCAACAGATGGTCTGCGATAGCTGCAAAATTGCCTGGACGAACAGACAACGAAATTAAAAATGTTTGGCACACTCATTTAAAGAAAAGACTCCACCACAGTCAAGATCAAAACAACAAGGAAGATTTCGTCTCTACTACAGCTGCGGAGATGCCAACCTCTCCGCAACAACAATCTAGTAGTAGTGCCGACATTTCAGCAATTACAACATTGGGAAACAACAATGACATCTCCAATAGCAACAAAGACTCCGCGACGTCATCCGAAGATGTTCTTGCAATTATAGATGAGAGCTTTTGGTCAGAAGTGGTATTGATGGACTGTGACATTTCAGGAAATGAGAAGAATGAGAAAAAGATAGAGAATTGGGAGGGCTCACTAGATAGAAACGATAAGGGATATAACCATGACATGGAGTTTTGGTTTGACCATCTCACTAGTAGTAGTTGTATAATTGGAGAAATGTCCGACATTTCTGAGTTTTGATTTGTTTTAGTTAAAGACTTATATATCTTCCTTTGTGACCCACATGAATAAAAGTCGTTTACGTTTCCTATATTAGTCCTCTTTCTATTTATCGTTCTATTACTTTTGGTTAGTTAAAATACAGATCAGGACATATGCTAAATGTTCGTATCATGTTATACATACATATATTATGATTTCTTTTTTC
CDS Sequence
- >AT1G06180.1
ATGGGGAGAAGACCATGCTGTGAGAAGATAGGATTGAAGAAAGGGCCATGGAGTGCTGAAGAAGATCGAATCTTGATCAATTATATTAGTCTCCATGGCCATCCCAATTGGAGAGCTCTCCCTAAACTAGCCGGGCTACTTCGGTGCGGAAAAAGTTGCAGGCTTCGTTGGATTAATTATTTGAGACCAGACATCAAACGTGGCAATTTCACTCCTCATGAAGAAGATACTATCATCAGCTTACATCAACTCTTAGGCAACAGATGGTCTGCGATAGCTGCAAAATTGCCTGGACGAACAGACAACGAAATTAAAAATGTTTGGCACACTCATTTAAAGAAAAGACTCCACCACAGTCAAGATCAAAACAACAAGGAAGATTTCGTCTCTACTACAGCTGCGGAGATGCCAACCTCTCCGCAACAACAATCTAGTAGTAGTGCCGACATTTCAGCAATTACAACATTGGGAAACAACAATGACATCTCCAATAGCAACAAAGACTCCGCGACGTCATCCGAAGATGTTCTTGCAATTATAGATGAGAGCTTTTGGTCAGAAGTGGTATTGATGGACTGTGACATTTCAGGAAATGAGAAGAATGAGAAAAAGATAGAGAATTGGGAGGGCTCACTAGATAGAAACGATAAGGGATATAACCATGACATGGAGTTTTGGTTTGACCATCTCACTAGTAGTAGTTGTATAATTGGAGAAATGTCCGACATTTCTGAGTTTTGA
Protein Sequence
- >AT1G06180.1
MGRRPCCEKIGLKKGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINYLRPDIKRGNFTPHEEDTIISLHQLLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLHHSQDQNNKEDFVSTTAAEMPTSPQQQSSSSADISAITTLGNNNDISNSNKDSATSSEDVLAIIDESFWSEVVLMDCDISGNEKNEKKIENWEGSLDRNDKGYNHDMEFWFDHLTSSSCIIGEMSDISEF