Information report for AT1G05340
Gene Details
|
|
Functional Descriptions
- PO:0000230 — inflorescence meristem — meristema de la inflorescencia (Spanish, exact), 花序分裂組織 (Japanese, exact)
- PO:0009030 — carpel — carpelo (Spanish, exact), 心皮 (Japanese, exact), Poaceae carpel (narrow), Zea carpel (narrow), pistil (broad)
- PO:0009032 — petal — pétalo (Spanish, exact), 花弁 (Japanese, exact)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
Functional Keywords
- inflorescence meristem , carpel , petal , stem , pollen , guard cell
Literature and News
- Vacuolar nicotianamine has critical and distinct roles under iron deficiency and for zinc sequestration in Arabidopsis. DOI: 10.1105/tpc.111.095042 ; PMID: 22374397
- Heavy Metals Need Assistance: The Contribution of Nicotianamine to Metal Circulation Throughout the Plant and the Arabidopsis NAS Gene Family. DOI: 10.3389/fpls.2011.00069 ; PMID: 22639605
- Nicotianamine functions in the Phloem-based transport of iron to sink organs, in pollen development and pollen tube growth in Arabidopsis. DOI: 10.1105/tpc.112.099077 ; PMID: 22706286
- Rice nicotianamine synthase localizes to particular vesicles for proper function. DOI: 10.4161/psb.28660 ; PMID: 24704865
- Map-based cloning of chloronerva, a gene involved in iron uptake of higher plants encoding nicotianamine synthase. DOI: 10.1073/pnas.96.12.7098 ; PMID: 10359845
- Isolation, characterization and cDNA cloning of nicotianamine synthase from barley. A key enzyme for iron homeostasis in plants. DOI: 10.1046/j.1432-1327.1999.00717.x ; PMID: 10491178
- Regulation of Arabidopsis brassinosteroid signaling by atypical basic helix-loop-helix proteins. DOI: 10.1105/tpc.109.072504 ; PMID: 20023194
- ATBS1 INTERACTING FACTORs negatively regulate Arabidopsis cell elongation in the triantagonistic bHLH system. DOI: 10.4161/psb.23448 ; PMID: 23333962
- The HECT ubiquitin-protein ligase (UPL) family in Arabidopsis: UPL3 has a specific role in trichome development. DOI: 10.1046/j.1365-313x.2003.01844.x ; PMID: 12969426
- Sulfate reduction is increased in transgenic Arabidopsis thaliana expressing 5'-adenylylsulfate reductase from Pseudomonas aeruginosa. DOI: 10.1046/j.1365-313x.2002.01477.x ; PMID: 12492831
- Identification and characterization of single-domain thiosulfate sulfurtransferases from Arabidopsis thaliana. DOI: 10.1016/s0014-5793(02)03723-7 ; PMID: 12482606
- Differential expression of Arabidopsis sulfurtransferases under various growth conditions. DOI: 10.1016/j.plaphy.2007.02.005 ; PMID: 17408957
- Identification of cleavage sites and substrate proteins for two mitochondrial intermediate peptidases in Arabidopsis thaliana. DOI: 10.1093/jxb/erv064 ; PMID: 25732537
- INTERMEDIATE CLEAVAGE PEPTIDASE55 Modifies Enzyme Amino Termini and Alters Protein Stability in Arabidopsis Mitochondria. DOI: 10.1104/pp.15.00300 ; PMID: 25862457
- AtOMA1 Affects the OXPHOS System and Plant Growth in Contrast to Other Newly Identified ATP-Independent Proteases in Arabidopsis Mitochondria. DOI: 10.3389/fpls.2017.01543 ; PMID: 28936218
- Involvement of ABA Responsive SVB Genes in the Regulation of Trichome Formation in Arabidopsis. DOI: 10.3390/ijms22136790 ; PMID: 34202673
- Arabidopsis AGDP1 links H3K9me2 to DNA methylation in heterochromatin. DOI: 10.1038/s41467-018-06965-w ; PMID: 30382101
- Plant HP1 protein ADCP1 links multivalent H3K9 methylation readout to heterochromatin formation. DOI: 10.1038/s41422-018-0104-9 ; PMID: 30425322
- Mutations in CHLOROPLAST RNA BINDING provide evidence for the involvement of the chloroplast in the regulation of the circadian clock in Arabidopsis. DOI: 10.1111/j.1365-313X.2007.03160.x ; PMID: 17617174
Gene Resources
- UniProt: A0A178W1D8
- EMBL: CACRSJ010000104, CACSHJ010000087, LR881466
- AlphaFoldDB: A0A178W1D8
- EnsemblPlants: AT1G05340.1
- Gramene: AT1G05340.1
- KEGG: ath:AT1G05340
- Orthologous matrix: GYPTNDP
- ExpressionAtlas: AT1G05340
- InterPro: IPR028144, IPR044850
- PANTHER: PTHR31568, PTHR31568:SF116
- OrthoDB: A0A178W1D8
Sequences
cDNA Sequence
- >AT1G05340.1
AAAACTTTGAACCACTTTGATTACTATATTATTTTTTTGGAATTTATTCTGGTGACATTAATGTTCTATCCTCCACGCGGTTCTCATAAACCGACTTGGCTTCTTTATTTTTCCTTTATCTTTCTCTATATATTTACACACACACGCATTTGTGCAGAGATATTCAAAGATTAGAAACATTCTTGATAGATACAAAAAACATTTTTCAGACACAAAATCATAAAATCTTTGCCTTTAGTAGATCAAAGTTCTTTACATTAATCGTTAGAAGATGAGCCAGTACGATCACAACCAGTCTGCAGGAGCTAACCCACCGCCACCGATGTCTACCTGTACATCACCACCACCGCCGATTGGTTACCCGACTAACCAACCGAGTCATGGTTCGGTAGCTCAGGGTAAAGTGGAAACCAAGTCTAAGGGTGACGGATTCTTCAAAGGCTGTCTTGCGGCCATGTGTTGCTGTTGTGCCCTGGACATTTGCTTCTAAGCCATTTGGGAATTGGGATGGTCTATTTATGACGAGTTTATGTGAATGTGATGTGAATTATTATTATTCTCTCCAGCCTTATTGTATAAATTCTCTATTTTTTGTTTATTATTTTCTTGTAATACTTTGTGAGACGAACATATTATGGTTTGTATTTGGATCTCTACTCTCTAGTACTTAAATTAATTTGTCTTGCTCTTGGATTGGTATAGTTAATAGCTTTAATCTCACAGAATTGCGCGTTTTTCTAATGATTTTCTGCAATTATAACAATAGATGAATCTAATTATTACAACTCATA
CDS Sequence
- >AT1G05340.1
ATGAGCCAGTACGATCACAACCAGTCTGCAGGAGCTAACCCACCGCCACCGATGTCTACCTGTACATCACCACCACCGCCGATTGGTTACCCGACTAACCAACCGAGTCATGGTTCGGTAGCTCAGGGTAAAGTGGAAACCAAGTCTAAGGGTGACGGATTCTTCAAAGGCTGTCTTGCGGCCATGTGTTGCTGTTGTGCCCTGGACATTTGCTTCTAA
Protein Sequence
- >AT1G05340.1
MSQYDHNQSAGANPPPPMSTCTSPPPPIGYPTNQPSHGSVAQGKVETKSKGDGFFKGCLAAMCCCCALDICF