Information report for AT1G04940
Gene Details
|
|
Functional Descriptions
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
- GO:0045037 — acts upstream of or within — protein import into chloroplast stroma
- GO:0009706 — located in — chloroplast inner membrane
- GO:0005515 — enables — protein binding
- GO:0009507 — located in — chloroplast
- GO:0005622 — located in — intracellular anatomical structure
- GO:0008320 — enables — protein transmembrane transporter activity
- CS73237 — Partial complementation of the tic20-I-1 phenotype. 35S:TIC20-IV transformants grow to a significantly larger size than untransformed tic20-I-1 control plants, but the construct is not able to restore normal greening to tic20-I-1 homozygotes.
- SALK_057175 — Increased root growth in DNA damaging media.
- cia5-2 tic20-I — Albino phenotype even in the youngest part of the seedling, which often accumulates anthocyanins.
- cia5-2 tic20-I — Seedlings grown in artificial media supplemented with sucrose are able to produce a few irregularly shaped leaves, followed by an arrest in growth. The timing of growth arrest varies from one seedling to the next leading to a variety of sizes and morphologies.
- tic20-I — Albino phenotype even in the youngest part of the seedling, which often accumulates anthocyanins.
- tic20-I — Seedlings grown in artificial media supplemented with sucrose are able to produce a few irregularly shaped leaves, followed by an arrest in growth. The timing of growth arrest varies from one seedling to the next leading to a variety of sizes and morphologies.
Functional Keywords
Literature and News
- A synthetic switch based on orange carotenoid protein to control blue-green light responses in chloroplasts. DOI: 10.1093/plphys/kiac122 ; PMID: 35289909
- High-resolution map of plastid-encoded RNA polymerase binding patterns demonstrates a major role of transcription in chloroplast gene expression. DOI: 10.1111/tpj.15882 ; PMID: 35765883
- Chloroplast development in Arabidopsis thaliana requires the nuclear-encoded transcription factor sigma B. DOI: 10.1016/s0014-5793(00)02216-x ; PMID: 11094163
- Photodamage of the photosynthetic apparatus and its dependence on the leaf developmental stage in the npq1 Arabidopsis mutant deficient in the xanthophyll cycle enzyme violaxanthin de-epoxidase. DOI: 10.1104/pp.124.1.273 ; PMID: 10982442
- Blue light-induced chloroplast relocation in Arabidopsis thaliana as analyzed by microbeam irradiation. DOI: 10.1093/pcp/41.1.84 ; PMID: 10750712
- Stomata from npq1, a zeaxanthin-less Arabidopsis mutant, lack a specific response to blue light. DOI: 10.1093/oxfordjournals.pcp.a029627 ; PMID: 10588066
- The violaxanthin cycle protects plants from photooxidative damage by more than one mechanism. DOI: 10.1073/pnas.96.15.8762 ; PMID: 10411949
- Arabidopsis mutants define a central role for the xanthophyll cycle in the regulation of photosynthetic energy conversion. DOI: 10.1105/tpc.10.7.1121 ; PMID: 9668132
- Xanthophyll cycle enzymes are members of the lipocalin family, the first identified from plants. DOI: 10.1074/jbc.273.25.15321 ; PMID: 9624110
- Comparison of violaxanthin de-epoxidation from the stroma and lumen sides of isolated thylakoid membranes from Arabidopsis: implications for the mechanism of de-epoxidation. DOI: 10.1007/s00425-002-0848-8 ; PMID: 12447545
- Plant lipocalins: violaxanthin de-epoxidase and zeaxanthin epoxidase. DOI: 10.1016/s0167-4838(00)00141-2 ; PMID: 11058750
- The protective functions of carotenoid and flavonoid pigments against excess visible radiation at chilling temperature investigated in Arabidopsis npq and tt mutants. DOI: 10.1007/s004250100572 ; PMID: 11722132
- Zeaxanthin deficiency enhances the high light sensitivity of an ascorbate-deficient mutant of Arabidopsis. DOI: 10.1104/pp.103.026252 ; PMID: 12972657
- Blue light and phytochrome-mediated stomatal opening in the npq1 and phot1 phot2 mutants of Arabidopsis. DOI: 10.1104/pp.103.029587 ; PMID: 14576287
- Carotenoid cation formation and the regulation of photosynthetic light harvesting. DOI: 10.1126/science.1105833 ; PMID: 15662017
- A mechanism of nonphotochemical energy dissipation, independent from PsbS, revealed by a conformational change in the antenna protein CP26. DOI: 10.1105/tpc.104.030601 ; PMID: 15749754
- Biochemical characterization of plasma membrane H+-ATPase activation in guard cell protoplasts of Arabidopsis thaliana in response to blue light. DOI: 10.1093/pcp/pci104 ; PMID: 15821287
- Vitamin E protects against photoinhibition and photooxidative stress in Arabidopsis thaliana. DOI: 10.1105/tpc.105.037036 ; PMID: 16258032
- Reversal by green light of blue light-stimulated stomatal opening in intact, attached leaves of Arabidopsis operates only in the potassium-dependent, morning phase of movement. DOI: 10.1093/pcp/pci249 ; PMID: 16418232
- High-performance liquid chromatography profiling of the major carotenoids in Arabidopsis thaliana leaf tissue. DOI: 10.1016/j.chroma.2006.04.033 ; PMID: 16701678
- On the induction of volatile organic compound emissions by plants as consequence of wounding or fluctuations of light and temperature. DOI: 10.1111/j.1365-3040.2006.01561.x ; PMID: 16913871
- The roles of specific xanthophylls in light utilization. DOI: 10.1007/s00425-006-0356-3 ; PMID: 16896791
- The Arabidopsis aba4-1 mutant reveals a specific function for neoxanthin in protection against photooxidative stress. DOI: 10.1105/tpc.106.049114 ; PMID: 17351115
- The transiently generated nonphotochemical quenching of excitation energy in Arabidopsis leaves is modulated by zeaxanthin. DOI: 10.1104/pp.106.095562 ; PMID: 17416642
- Zeaxanthin has enhanced antioxidant capacity with respect to all other xanthophylls in Arabidopsis leaves and functions independent of binding to PSII antennae. DOI: 10.1104/pp.107.108480 ; PMID: 17932304
- The zeaxanthin-independent and zeaxanthin-dependent qE components of nonphotochemical quenching involve common conformational changes within the photosystem II antenna in Arabidopsis. DOI: 10.1104/pp.108.129957 ; PMID: 19011000
- How does cyclic electron flow alleviate photoinhibition in Arabidopsis? DOI: 10.1104/pp.108.134122 ; PMID: 19118124
Gene Resources
- UniProt: A0A178W3W6
- EMBL: LR881466, LUHQ01000001
- AlphaFoldDB: A0A178W3W6
- EnsemblPlants: AT1G04940.1
- Gramene: AT1G04940.1
- KEGG: ath:AT1G04940
- Orthologous matrix: FFRFHTI
- ExpressionAtlas: AT1G04940
- InterPro: IPR005691
- PANTHER: PTHR33510, PTHR33510:SF9
- SWISS-MODEL: A0A178W3W6
Sequences
cDNA Sequence
- >AT1G04940.1
GAGAGAGTAATCGCCATTTTTCTTTATTGGGGGAGTGAAGAAGGATAGGATTCAGATGATGAAGTACAGATGAATGCTCCATAAACCCTACTCTTCTTCTTTTACCTCCAGCTTCGATTATACCATTCCTTGTTTGTGAAGGCATTTTAGTTGGTAAGGATGATAACTGGATACAGCACGCCAAGTGCACATGTTCTAATGAGCTCTCGGGCATTCAAGTCATCATCATATAGAGCTGCAGCAGGACAGACTCAACATTATCTTGCTCGAAGTTCATTGCCTGTCGTAAAGAACTCGTGGGGATCACCACCTTCACCTTTCAATGAGCTTCCGAGAGTGTCAAGAGGTGTGCCTCTGTCATATCTCTCAGCCTCGTCTTCTCTGCTTCTGAATGGAGAACAAGGTAGTCTATCTGGTACATTACCTGTGTTACCTGTCCGCAGAAAAACTCTTTTGACTCCACGAGCGTCAAAAGATGTACCTTCTAGCTTCCGATTTCCCCCGATGACCAAGAAGCCACAATGGTGGTGGAGAACTTTGGCTTGCCTGCCTTACCTAATGCCACTGCATGAAACTTGGATGTATGCAGAAACCGCTTACCATCTCCACCCATTCCTAGAAGATTTTGAATTCTTAACCTACCCATTTCTAGGCGCCATAGGAAGATTACCAAGCTGGTTCCTCATGGCTTACTTTTTTGTAGCTTATCTAGGGATAGTGCGAAGAAAAGAATGGCCTCACTTCTTCAGGTTCCATGTAGTGATGGGTATGCTGCTTGAAATCGCACTCCAGGTTATAGGGACCGTTAGCAAGTGGATGCCTCTTGGAGTCTATTGGGGTAAGTTTGGGATGCATTTCTGGACTGCTGTTGCGTTTGCTTATCTGTTTACCGTCCTTGAAAGCATACGGTGTGCACTTGCGGGTATGTACGCAGACATCCCGTTTGTCTGTGATGCTGCCTATATCCAGATTCCGTACGACTAAGAAGAAACAACATTGGATCGTTATGACTCCTCTTTTTTTTTTTTTTTGTTAATTAGGTCCTTGTTTTGTTGTTACAATGACTCTTCTTGAATGACAATTATGTTTGTAATCAACGTTTCATGAACGCAGCCGTCAAAGTTACAAACTTTTGAACATGGATTGGCTATGAAACCAAAAATATAATCGAACATTTTTGGGGGTGTATTTTGGGAAA
CDS Sequence
- >AT1G04940.1
ATGATAACTGGATACAGCACGCCAAGTGCACATGTTCTAATGAGCTCTCGGGCATTCAAGTCATCATCATATAGAGCTGCAGCAGGACAGACTCAACATTATCTTGCTCGAAGTTCATTGCCTGTCGTAAAGAACTCGTGGGGATCACCACCTTCACCTTTCAATGAGCTTCCGAGAGTGTCAAGAGGTGTGCCTCTGTCATATCTCTCAGCCTCGTCTTCTCTGCTTCTGAATGGAGAACAAGGTAGTCTATCTGGTACATTACCTGTGTTACCTGTCCGCAGAAAAACTCTTTTGACTCCACGAGCGTCAAAAGATGTACCTTCTAGCTTCCGATTTCCCCCGATGACCAAGAAGCCACAATGGTGGTGGAGAACTTTGGCTTGCCTGCCTTACCTAATGCCACTGCATGAAACTTGGATGTATGCAGAAACCGCTTACCATCTCCACCCATTCCTAGAAGATTTTGAATTCTTAACCTACCCATTTCTAGGCGCCATAGGAAGATTACCAAGCTGGTTCCTCATGGCTTACTTTTTTGTAGCTTATCTAGGGATAGTGCGAAGAAAAGAATGGCCTCACTTCTTCAGGTTCCATGTAGTGATGGGTATGCTGCTTGAAATCGCACTCCAGGTTATAGGGACCGTTAGCAAGTGGATGCCTCTTGGAGTCTATTGGGGTAAGTTTGGGATGCATTTCTGGACTGCTGTTGCGTTTGCTTATCTGTTTACCGTCCTTGAAAGCATACGGTGTGCACTTGCGGGTATGTACGCAGACATCCCGTTTGTCTGTGATGCTGCCTATATCCAGATTCCGTACGACTAA
Protein Sequence
- >AT1G04940.1
MITGYSTPSAHVLMSSRAFKSSSYRAAAGQTQHYLARSSLPVVKNSWGSPPSPFNELPRVSRGVPLSYLSASSSLLLNGEQGSLSGTLPVLPVRRKTLLTPRASKDVPSSFRFPPMTKKPQWWWRTLACLPYLMPLHETWMYAETAYHLHPFLEDFEFLTYPFLGAIGRLPSWFLMAYFFVAYLGIVRRKEWPHFFRFHVVMGMLLEIALQVIGTVSKWMPLGVYWGKFGMHFWTAVAFAYLFTVLESIRCALAGMYADIPFVCDAAYIQIPYD