Gene Details:
- Gene ID: AT1G03130
- Gene Symbol: PSAD-2
- Gene Name: photosystem I subunit D-2
- Description: photosystem I subunit D-2;(source:Araport11)
- TAIR Accession:
- Genome: Araport11_genome_release
- Species: Arabidopsis thaliana
Transcripts:
Plant Ontology Annotations:
- PO:0000013 — cauline leaf — hoja caulinar (Spanish, exact), 茎生葉、茎葉 (Japanese, exact)
- PO:0000230 — inflorescence meristem — meristema de la inflorescencia (Spanish, exact), 花序分裂組織 (Japanese, exact)
- PO:0009010 — seed — semilla (Spanish, exact), 種子 (Japanese, exact), pyrene (narrow), diaspore (broad)
- PO:0009030 — carpel — carpelo (Spanish, exact), 心皮 (Japanese, exact), Poaceae carpel (narrow), Zea carpel (narrow), pistil (broad)
- PO:0009032 — petal — pétalo (Spanish, exact), 花弁 (Japanese, exact)
- PO:0009047 — stem — caña (Spanish, exact), culm (exact), eje primario (Spanish, exact), primary axis (exact), primary stem (exact), tallo (Spanish, exact), tronco (Spanish, exact), 茎 (Japanese, exact), bole (narrow), cane (narrow), caudex (narrow), caudices (narrow), core (narrow), primocane (narrow), scape (narrow), stalk (narrow), trunk (narrow)
- PO:0025281 — pollen — polen (Spanish, exact), pollen grain (exact), 花粉 (Japanese, exact)
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
Function-related keywords:
- cauline leaf , inflorescence meristem , seed , carpel , petal , stem , pollen , guard cell
Literature:
- The blue light-induced interaction of cryptochrome 1 with COP1 requires SPA proteins during Arabidopsis light signaling. DOI: 10.1371/journal.pgen.1007044 ; PMID: 28991901
- Optimized light-inducible transcription in mammalian cells using Flavin Kelch-repeat F-box1/GIGANTEA and CRY2/CIB1. DOI: 10.1093/nar/gkx804 ; PMID: 29040770
- Blue-light induced biosynthesis of ROS contributes to the signaling mechanism of Arabidopsis cryptochrome. DOI: 10.1038/s41598-017-13832-z ; PMID: 29066723
- FIN219/JAR1 and cryptochrome1 antagonize each other to modulate photomorphogenesis under blue light in Arabidopsis. DOI: 10.1371/journal.pgen.1007248 ; PMID: 29561841
- Do UV-A radiation and blue light during growth prime leaves to cope with acute high light in photoreceptor mutants of Arabidopsis thaliana? DOI: 10.1111/ppl.12749 ; PMID: 29704249
- Geomagnetic field impacts on cryptochrome and phytochrome signaling. DOI: 10.1016/j.jphotobiol.2018.05.027 ; PMID: 29864723
- CRY1 interacts directly with HBI1 to regulate its transcriptional activity and photomorphogenesis in Arabidopsis. DOI: 10.1093/jxb/ery209 ; PMID: 29860272
- Optical Activation of TrkA Signaling. DOI: 10.1021/acssynbio.8b00126 ; PMID: 29975841
- Reconstituting Arabidopsis CRY2 Signaling Pathway in Mammalian Cells Reveals Regulation of Transcription by Direct Binding of CRY2 to DNA. DOI: 10.1016/j.celrep.2018.06.069 ; PMID: 30021157
- ATP boosts lit state formation and activity of Arabidopsis cryptochrome 2. DOI: 10.1111/tpj.14039 ; PMID: 30044014
- Long-Day Photoperiod Enhances Jasmonic Acid-Related Plant Defense. DOI: 10.1104/pp.18.00443 ; PMID: 30068539
- Correction: FIN219/JAR1 and cryptochrome1 antagonize each other to modulate photomorphogenesis under blue light in Arabidopsis. DOI: 10.1371/journal.pgen.1007606 ; PMID: 30114209
- Photoexcited CRYPTOCHROME1 Interacts with Dephosphorylated BES1 to Regulate Brassinosteroid Signaling and Photomorphogenesis in Arabidopsis. DOI: 10.1105/tpc.17.00994 ; PMID: 30131420
- CIB1 and CO interact to mediate CRY2-dependent regulation of flowering. DOI: 10.15252/embr.201845762 ; PMID: 30126927
- Regulation of flowering by green light depends on its photon flux density and involves cryptochromes. DOI: 10.1111/ppl.12832 ; PMID: 30187495
- Extrachloroplastic PP7L Functions in Chloroplast Development and Abiotic Stress Tolerance. DOI: 10.1104/pp.19.00070 ; PMID: 30760637
- Impact of UV-B radiation on the photosystem II activity, pro-/antioxidant balance and expression of light-activated genes in Arabidopsis thaliana hy4 mutants grown under light of different spectral composition. DOI: 10.1016/j.jphotobiol.2019.02.003 ; PMID: 30897399
- Cryptochrome-mediated hypocotyl phototropism was regulated antagonistically by gibberellic acid and sucrose in Arabidopsis. DOI: 10.1111/jipb.12813 ; PMID: 30941890
- BES1-regulated BEE1 controls photoperiodic flowering downstream of blue light signaling pathway in Arabidopsis. DOI: 10.1111/nph.15866 ; PMID: 31009078
- Regulation of Arabidopsis gene expression by low fluence rate UV-B independently of UVR8 and stress signaling. DOI: 10.1039/c9pp00151d ; PMID: 31218318
- The Universally Conserved Residues Are Not Universally Required for Stable Protein Expression or Functions of Cryptochromes. DOI: 10.1093/molbev/msz217 ; PMID: 31550045
- Static magnetic field regulates Arabidopsis root growth via auxin signaling. DOI: 10.1038/s41598-019-50970-y ; PMID: 31591431
- The Arabidopsis cryptochrome 2 I404F mutant is hypersensitive and shows flavin reduction even in the absence of light. DOI: 10.1007/s00425-019-03323-y ; PMID: 31832774
- Cryptochrome 2 competes with COP1 substrates to repress COP1 ubiquitin ligase activity during Arabidopsis photomorphogenesis. DOI: 10.1073/pnas.1909181116 ; PMID: 31822614
- Photooligomerization Determines Photosensitivity and Photoreactivity of Plant Cryptochromes. DOI: 10.1016/j.molp.2020.01.002 ; PMID: 31953223
Sequences:
cDNA Sequence
- >AT1G03130.1
GATCACCTTATCCCAAAATGTTCGATTCTCATCTACCCTCTCGTTGTCAGATTCTATTAAGCCATTTCATCTCTATCCATTTACTCCACAGAGAAAGATTCAGAGAAAACAGAAGAAACTATGGCAACTCAAGCCGCCGGAATCTTCAGCCCCGCCATAACAACCACTACTTCCGCCGTCAAGAAACTCCACCTCTTCTCATCAAGCCACCGTCCCAAGTCTCTCTCCTTCACCAAAACCGCCATCCGCGCCGAGAAAACAGAGTCCTCCTCTGCTGCCCCAGCCGTGAAAGAAGCTCCAGTTGGATTCACTCCCCCGCAGCTAGACCCAAACACACCATCACCAATCTTCGCCGGAAGCACAGGAGGTCTCCTCCGTAAAGCACAAGTAGAGGAATTTTACGTGATCACATGGAACTCACCGAAAGAACAAATCTTTGAGATGCCAACAGGAGGAGCTGCGATAATGAGAGAAGGACCGAATCTATTGAAACTGGCGAGGAAAGAACAGTGTTTGGCTTTAGGTACGAGGTTGAGGTCAAAGTACAAGATCACTTACCAGTTTTACAGAGTGTTCCCTAACGGAGAGGTTCAATATCTTCACCCGAAAGATGGAGTTTATCCAGAGAAAGCGAATCCAGGAAGAGAAGGTGTTGGACTAAACATGAGATCCATCGGTAAAAATGTTAGTCCCATTGAGGTTAAATTCACTGGGAAACAATCTTATGATTTGTAAGATTTTAATTCGTATTTTATATAATAATGCTAGACAAACAAAACAAATTTAAAAAGGGATCACACTACATGTAAAATCTTGCGGATGTTATAACAACTCTTTGAACTTTTCAAGCAGCTTTGTTTTGGTTTTGTCGATCGAGTGATACCATATCATGTGGTAAGTGAAATTCTCTAGTTTGAGAAAGACAAAAAAAAAGTCCATTACTTGGGACAGGGTTT
CDS Sequence
- >AT1G03130.1
ATGGCAACTCAAGCCGCCGGAATCTTCAGCCCCGCCATAACAACCACTACTTCCGCCGTCAAGAAACTCCACCTCTTCTCATCAAGCCACCGTCCCAAGTCTCTCTCCTTCACCAAAACCGCCATCCGCGCCGAGAAAACAGAGTCCTCCTCTGCTGCCCCAGCCGTGAAAGAAGCTCCAGTTGGATTCACTCCCCCGCAGCTAGACCCAAACACACCATCACCAATCTTCGCCGGAAGCACAGGAGGTCTCCTCCGTAAAGCACAAGTAGAGGAATTTTACGTGATCACATGGAACTCACCGAAAGAACAAATCTTTGAGATGCCAACAGGAGGAGCTGCGATAATGAGAGAAGGACCGAATCTATTGAAACTGGCGAGGAAAGAACAGTGTTTGGCTTTAGGTACGAGGTTGAGGTCAAAGTACAAGATCACTTACCAGTTTTACAGAGTGTTCCCTAACGGAGAGGTTCAATATCTTCACCCGAAAGATGGAGTTTATCCAGAGAAAGCGAATCCAGGAAGAGAAGGTGTTGGACTAAACATGAGATCCATCGGTAAAAATGTTAGTCCCATTGAGGTTAAATTCACTGGGAAACAATCTTATGATTTGTAA
Protein Sequence
- >AT1G03130.1
MATQAAGIFSPAITTTTSAVKKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGKQSYDL