Information report for AT1G02930
Gene Details
|
|
Functional Descriptions
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
- GO:0005507 — enables — copper ion binding
- GO:0005737 — is active in — cytoplasm
- GO:0009414 — acts upstream of or within — response to water deprivation
- GO:0009507 — located in — chloroplast
- GO:0043295 — enables — glutathione binding
- GO:0009407 — acts upstream of or within — toxin catabolic process
- GO:0005739 — located in — mitochondrion
- GO:0006979 — acts upstream of or within — response to oxidative stress
- GO:0010494 — located in — cytoplasmic stress granule
- GO:0005576 — located in — extracellular region
- GO:0046686 — acts upstream of or within — response to cadmium ion
- GO:0005829 — located in — cytosol
- GO:0006749 — involved in — glutathione metabolic process
- GO:0050897 — enables — cobalt ion binding
- GO:0004364 — enables — glutathione transferase activity
- GO:2001227 — enables — quercitrin binding
- GO:0005737 — located in — cytoplasm
Functional Keywords
Literature and News
- The Arabidopsis SUPPRESSOR OF AUXIN RESISTANCE proteins are nucleoporins with an important role in hormone signaling and development. DOI: 10.1105/tpc.106.041566 ; PMID: 16751346
- pax1-1 partially suppresses gain-of-function mutations in Arabidopsis AXR3/IAA17. DOI: 10.1186/1471-2229-7-20 ; PMID: 17430601
- Ubiquitin C-terminal hydrolases 1 and 2 affect shoot architecture in Arabidopsis. DOI: 10.1111/j.1365-313X.2007.03154.x ; PMID: 17559514
- Salicylic acid inhibits pathogen growth in plants through repression of the auxin signaling pathway. DOI: 10.1016/j.cub.2007.09.025 ; PMID: 17919906
- Phosphate availability alters lateral root development in Arabidopsis by modulating auxin sensitivity via a mechanism involving the TIR1 auxin receptor. DOI: 10.1105/tpc.108.058719 ; PMID: 19106375
- Constitutive repression and activation of auxin signaling in Arabidopsis. DOI: 10.1104/pp.108.129973 ; PMID: 19129421
- Glucose and auxin signaling interaction in controlling Arabidopsis thaliana seedlings root growth and development. DOI: 10.1371/journal.pone.0004502 ; PMID: 19223973
- Brassinosteroid signals control expression of the AXR3/IAA17 gene in the cross-talk point with auxin in root development. DOI: 10.1271/bbb.70.768 ; PMID: 16636440
- Repression of the auxin response pathway increases Arabidopsis susceptibility to necrotrophic fungi. DOI: 10.1093/mp/ssn025 ; PMID: 19825556
- Resistance and biomass in Arabidopsis: a new model for salicylic acid perception. DOI: 10.1111/j.1467-7652.2009.00468.x ; PMID: 20040060
- A theoretical model for ROP localisation by auxin in Arabidopsis root hair cells. DOI: 10.1371/journal.pone.0008337 ; PMID: 20016781
- Auxin regulates distal stem cell differentiation in Arabidopsis roots. DOI: 10.1073/pnas.1000672107 ; PMID: 20543136
- Arabidopsis root growth dependence on glutathione is linked to auxin transport. DOI: 10.1007/s00299-010-0902-0 ; PMID: 20669021
- A role for AUXIN RESISTANT3 in the coordination of leaf growth. DOI: 10.1093/pcp/pcq123 ; PMID: 20739302
- Auxin-induced inhibition of lateral root initiation contributes to root system shaping in Arabidopsis thaliana. DOI: 10.1111/j.1365-313X.2010.04365.x ; PMID: 21105922
- Do some IAA proteins have two repression domains? DOI: 10.4161/psb.6.6.15205 ; PMID: 21543900
- A gain-of-function mutation in IAA16 confers reduced responses to auxin and abscisic acid and impedes plant growth and fertility. DOI: 10.1007/s11103-012-9917-y ; PMID: 22580954
- IAA8 involved in lateral root formation interacts with the TIR1 auxin receptor and ARF transcription factors in Arabidopsis. DOI: 10.1371/journal.pone.0043414 ; PMID: 22912871
- Natural Arabidopsis brx loss-of-function alleles confer root adaptation to acidic soil. DOI: 10.1016/j.cub.2012.08.026 ; PMID: 23041192
- The interaction between glucose and cytokinin signal transduction pathway in Arabidopsis thaliana. DOI: 10.1111/pce.12149 ; PMID: 23763631
- WOX5-IAA17 feedback circuit-mediated cellular auxin response is crucial for the patterning of root stem cell niches in Arabidopsis. DOI: 10.1093/mp/sst118 ; PMID: 23939433
- Auxin gradient is crucial for the maintenance of root distal stem cell identity in Arabidopsis. DOI: 10.4161/psb.26429 ; PMID: 24056047
- Molecular basis for AUXIN RESPONSE FACTOR protein interaction and the control of auxin response repression. DOI: 10.1073/pnas.1400074111 ; PMID: 24706860
- INDOLE-3-ACETIC ACID INDUCIBLE 17 positively modulates natural leaf senescence through melatonin-mediated pathway in Arabidopsis. DOI: 10.1111/jpi.12188 ; PMID: 25324183
- Salt stress reduces root meristem size by nitric oxide-mediated modulation of auxin accumulation and signaling in Arabidopsis. DOI: 10.1104/pp.15.00030 ; PMID: 25818700
- Inhibition of root meristem growth by cadmium involves nitric oxide-mediated repression of auxin accumulation and signalling in Arabidopsis. DOI: 10.1111/pce.12597 ; PMID: 26138870
- Germostatin resistance locus 1 encodes a PHD finger protein involved in auxin-mediated seed dormancy and germination. DOI: 10.1111/tpj.13086 ; PMID: 26611158
- and Salicylic Acid-Signaling Pathways in the Regulation of PINOID Transcription. DOI: 10.1371/journal.pone.0157168 ; PMID: 27275924
- Structural basis for the auxin-induced transcriptional regulation by Aux/IAA17. DOI: 10.1073/pnas.1419525112 ; PMID: 25512488
- Integration of auxin/indole-3-acetic acid 17 and RGA-LIKE3 confers salt stress resistance through stabilization by nitric oxide in Arabidopsis. DOI: 10.1093/jxb/erw508 ; PMID: 28158805
- The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development. DOI: 10.1080/15592324.2017.1312241 ; PMID: 28467152
- Enhanced Arabidopsis disease resistance against Botrytis cinerea induced by sulfur dioxide. DOI: 10.1016/j.ecoenv.2017.09.011 ; PMID: 28917191
- Lanthanum Inhibits Primary Root Growth by Repressing Auxin Carrier Abundances in Arabidopsis. DOI: 10.3389/fpls.2017.01661 ; PMID: 28993788
- WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity. DOI: 10.1371/journal.pgen.1007177 ; PMID: 29377885
- Zinc finger of Arabidopsis thaliana 6 is involved in melatonin-mediated auxin signaling through interacting INDETERMINATE DOMAIN15 and INDOLE-3-ACETIC ACID 17. DOI: 10.1111/jpi.12494 ; PMID: 29607541
- Rewiring of auxin signaling under persistent shade. DOI: 10.1073/pnas.1721110115 ; PMID: 29724856
- Auxin-mediated statolith production for root gravitropism. DOI: 10.1111/nph.15932 ; PMID: 31111487
- A Molecular Framework for the Control of Adventitious Rooting by TIR1/AFB2-Aux/IAA-Dependent Auxin Signaling in Arabidopsis. DOI: 10.1016/j.molp.2019.09.001 ; PMID: 31520787
- Determinants of PB1 Domain Interactions in Auxin Response Factor ARF5 and Repressor IAA17. DOI: 10.1016/j.jmb.2020.04.007 ; PMID: 32305460
- The Type-B Cytokinin Response Regulator ARR1 Inhibits Shoot Regeneration in an ARR12-Dependent Manner in Arabidopsis. DOI: 10.1105/tpc.19.00022 ; PMID: 32398274
- Non-TZF Protein AtC3H59/ZFWD3 Is Involved in Seed Germination, Seedling Development, and Seed Development, Interacting with PPPDE Family Protein Desi1 in Arabidopsis. DOI: 10.3390/ijms22094738 ; PMID: 33947021
- Diketopiperazine Modulates Arabidopsis thaliana Root System Architecture by Promoting Interactions of Auxin Receptor TIR1 and IAA7/17 Proteins. DOI: 10.1093/pcp/pcab142 ; PMID: 34534338
- Overexpression of HLH4 Inhibits Cell Elongation and Anthocyanin Biosynthesis in Arabidopsis thaliana. DOI: 10.3390/cells11071087 ; PMID: 35406652
- SUMO E3 ligase AtMMS21-dependent SUMOylation of AUXIN/INDOLE-3-ACETIC ACID 17 regulates auxin signaling. DOI: 10.1093/plphys/kiac553 ; PMID: 36464768
- Nitric oxide-mediated S-nitrosylation of IAA17 protein in intrinsically disordered region represses auxin signaling. DOI: 10.1016/j.jgg.2023.05.001 ; PMID: 37187411
- Identification of arabidopsis proteins that interact with the cauliflower mosaic virus (CaMV) movement protein. DOI: 10.1023/a:1012491913431 ; PMID: 11725951
- The PRA1 gene family in Arabidopsis. DOI: 10.1104/pp.108.122226 ; PMID: 18583532
- Characterization and mapping of the Xiphophorus maculatus (Teleostei: Poeciliidae) RPS15 gene. DOI: 10.1159/000134465 ; PMID: 9040780
- The Arabidopsis thaliana ribosomal protein S15 (rig) gene. DOI: 10.1016/0167-4781(93)90148-7 ; PMID: 7916644
- High diversity of plastidial promoters in Arabidopsis thaliana. DOI: 10.1007/s00438-007-0222-4 ; PMID: 17333279
- A zinc knuckle protein that negatively controls morning-specific growth in Arabidopsis thaliana. DOI: 10.1073/pnas.0807264105 ; PMID: 18971337
- Plant ornithine decarboxylase is not post-transcriptionally feedback regulated by polyamines but can interact with a cytosolic ribosomal protein S15 polypeptide. DOI: 10.1007/s00726-011-1029-5 ; PMID: 21814791
- Linkage disequilibrium mapping of Arabidopsis CRY2 flowering time alleles. DOI: 10.1534/genetics.103.024950 ; PMID: 15280248
- NA DOI: NA ; PMID: 33891018
- Plant TRAF Proteins Regulate NLR Immune Receptor Turnover. DOI: 10.1016/j.chom.2016.01.005 ; PMID: 26867179
- TRAF Family Proteins Regulate Autophagy Dynamics by Modulating AUTOPHAGY PROTEIN6 Stability in Arabidopsis. DOI: 10.1105/tpc.17.00056 ; PMID: 28351989
- SCF(SNIPER4) controls the turnover of two redundant TRAF proteins in plant immunity. DOI: 10.1111/tpj.13965 ; PMID: 29770510
- NA DOI: NA ; PMID: 33792709
- Local patterns of nucleotide polymorphism are highly variable in the selfing species Arabidopsis thaliana. DOI: 10.1007/s00239-007-9063-3 ; PMID: 18273534
- Ethylene perception by the ERS1 protein in Arabidopsis. DOI: 10.1104/pp.123.4.1449 ; PMID: 10938361
- EIN4 and ERS2 are members of the putative ethylene receptor gene family in Arabidopsis. DOI: 10.1105/tpc.10.8.1321 ; PMID: 9707532
- Ethylene responses are negatively regulated by a receptor gene family in Arabidopsis thaliana. DOI: 10.1016/s0092-8674(00)81425-7 ; PMID: 9695954
Gene Resources
- UniProt: A0A178WN35
- EMBL: CACRSJ010000104, CACSHJ010000087, LR881466
- AlphaFoldDB: A0A178WN35
- EnsemblPlants: AT1G02930.1, AT1G02930.2
- Gramene: AT1G02930.1, AT1G02930.2
- KEGG: ath:AT1G02930
- Orthologous matrix: KNVDFEF
- ExpressionAtlas: AT1G02930
- InterPro: IPR004045, IPR004046, IPR010987
- PANTHER: PTHR43900, PTHR43900:SF47
- SUPFAM: SSF47616, SSF52833
- PROSITE: PS50404, PS50405
- Gene3D: 1.20.1050.10, 3.40.30.10
- OrthoDB: A0A178WN35
- SWISS-MODEL: A0A178WN35
- Conserved Domain Database: cd03053, cd03187
Homologs
Sequences
cDNA Sequence
- >AT1G02930.1
TCTTGAACCAATAGAAACGACGAATCATACATTACTCAGCTTGACTTTGAAATAATCCTATAACAAAAGAGCATTCCAAGAATTTTATCCAAAAAACAAAATAAAAAAGAGTATTCAAGCTTGGTGGCGCCGTTTGTTTTTGGTTTATTCACTAAAGTTACTCTGTTTTAGTTGTATAAATACACACTCCCATTTGTGTATTTCTTTTCATCAATCACAAAGATCTCTCTACTTCAATAAATCTCCACCTTACTTTAAGAACAAGAAAAACACAGTATTAACAAATGGCAGGAATCAAAGTTTTCGGTCACCCAGCTTCCACAGCCACTAGAAGAGTTCTCATCGCTCTTCACGAGAAGAATGTCGACTTTGAATTCGTTCATGTCGAGCTCAAAGATGGTGAACACAAGAAAGAGCCTTTCATCCTTCGCAACCCCTTTGGTAAAGTTCCAGCCTTTGAAGATGGAGACTTCAAGATTTTCGAATCAAGAGCAATTACTCAATACATAGCTCATGAATTCTCAGACAAAGGAAACAACCTTCTCTCAACTGGCAAGGACATGGCGATCATAGCCATGGGCATTGAAATTGAGTCGCATGAGTTTGACCCAGTTGGTTCAAAGCTTGTTTGGGAGCAAGTCTTAAAGCCTTTGTATGGTATGACCACAGACAAAACCGTTGTTGAAGAAGAAGAGGCTAAGCTAGCCAAAGTCCTCGATGTTTACGAACACAGGCTTGGTGAGTCCAAGTATTTGGCTTCTGACCACTTCACTTTGGTCGATCTTCACACTATCCCTGTGATTCAATACTTACTTGGAACTCCAACTAAGAAACTCTTCGACGAGCGTCCACATGTGAGTGCTTGGGTTGCTGACATCACTTCAAGGCCTTCTGCTCAGAAGGTTCTTTAAGTGAATCTCAAACTATTTATCGATCAGAAGATGTAATAAAAGTGGCGATGACCTAATTGCCCAATTCTCATAAACTCTGTTTTTCTTTTTGTGTTTACTCTGTTTTTCTGCTGCCGAGTGTTTGATTTGAATGTAATCTTCGATAATGAGTCTTGATATAATAAAATATTTCTTATCTTAAAGTTTAACTACCAATTAATGTTGATCTCATTCTTCAAAGTTGACTATCATTCTCCTAAGTCTTGAACGTTGACTTCCAAATTAGGTCGCTCTGC - >AT1G02930.2
TCTTGAACCAATAGAAACGACGAATCATACATTACTCAGCTTGACTTTGAAATAATCCTATAACAAAAGAGCATTCCAAGAATTTTATCCAAAAAACAAAATAAAAAAGAGTATTCAAGCTTGGTGGCGCCGTTTGTTTTTGGTTTATTCACTAAAGTTACTCTGTTTTAGTTGTATAAATACACACTCCCATTTGTGTATTTCTTTTCATCAATCACAAAGATCTCTCTACTTCAATAAATCTCCACCTTACTTTAAGAACAAGAAAAACACAGTATTAACAAATGGCAGGAATCAAAGTTTTCGGTCACCCAGCTTCCACAGCCACTAGAAGAGTTCTCATCGCTCTTCACGAGAAGAATGTCGACTTTGAATTCGTTCATGTCGAGCTCAAAGATGGTGAACACAAGAAAGAGCCTTTCATCCTTCGCAACCCCTTTGGTAAAGTTCCAGCCTTTGAAGATGGAGACTTCAAGATTTTCGAATCAAGAGCAATTACTCAATACATAGCTCATGAATTCTCAGACAAAGGAAACAACCTTCTCTCAACTGGCAAGGACATGGCGATCATAGCCATGGGCATTGAAATTGAGTCGCATGAGTTTGACCCAGTTGGTTCAAAGCTTGTTTGGGAGCAAGTCTTAAAGCCTTTGTATGGTATGACCACAGACAAAACCGTTGTTGAAGAAGAAGAGGCTAAGCTAGCCAAAGTCCTCGATGTTTACGAACACAGGCTTGGTGAGTCCAAGTATTTGGCTTCTGACCACTTCACTTTGGTCGATCTTCACACTATCCCTGTGATTCAATACTTACTTGGAACTCCAACTAAGAAACTCTTCGACGAGCGTCCACATGTGAGTGCTTGGGTTGCTGACATCACTTCAAGGCCTTCTGCTCAGAAGGTTCTTTAAGTGAATCTCAAACTATTTATCGATCAGAAGATGTAATAAAAGTGGCGATGACCTAATTGCCCAATTCTCATAAACTCTGTTTTTCTTTTTGTGTTTACTCTGTTTTTCTGCTGCCGAGTGTTTGATTTGAATGTAATCTTCGATAATGAGTCTTGATATAATAAAATATTTCTTATCTTAAAGTTTAACTACCAATTAATGTTGATCTCATTCTTCAAAGTTGACTATCATTCTCCTAAGTCTTGAACGTTGACTTCCAAATTAGGTCGCTCTGC
CDS Sequence
- >AT1G02930.1
ATGGCAGGAATCAAAGTTTTCGGTCACCCAGCTTCCACAGCCACTAGAAGAGTTCTCATCGCTCTTCACGAGAAGAATGTCGACTTTGAATTCGTTCATGTCGAGCTCAAAGATGGTGAACACAAGAAAGAGCCTTTCATCCTTCGCAACCCCTTTGGTAAAGTTCCAGCCTTTGAAGATGGAGACTTCAAGATTTTCGAATCAAGAGCAATTACTCAATACATAGCTCATGAATTCTCAGACAAAGGAAACAACCTTCTCTCAACTGGCAAGGACATGGCGATCATAGCCATGGGCATTGAAATTGAGTCGCATGAGTTTGACCCAGTTGGTTCAAAGCTTGTTTGGGAGCAAGTCTTAAAGCCTTTGTATGGTATGACCACAGACAAAACCGTTGTTGAAGAAGAAGAGGCTAAGCTAGCCAAAGTCCTCGATGTTTACGAACACAGGCTTGGTGAGTCCAAGTATTTGGCTTCTGACCACTTCACTTTGGTCGATCTTCACACTATCCCTGTGATTCAATACTTACTTGGAACTCCAACTAAGAAACTCTTCGACGAGCGTCCACATGTGAGTGCTTGGGTTGCTGACATCACTTCAAGGCCTTCTGCTCAGAAGGTTCTTTAA - >AT1G02930.2
ATGGCAGGAATCAAAGTTTTCGGTCACCCAGCTTCCACAGCCACTAGAAGAGTTCTCATCGCTCTTCACGAGAAGAATGTCGACTTTGAATTCGTTCATGTCGAGCTCAAAGATGGTGAACACAAGAAAGAGCCTTTCATCCTTCGCAACCCCTTTGGTAAAGTTCCAGCCTTTGAAGATGGAGACTTCAAGATTTTCGAATCAAGAGCAATTACTCAATACATAGCTCATGAATTCTCAGACAAAGGAAACAACCTTCTCTCAACTGGCAAGGACATGGCGATCATAGCCATGGGCATTGAAATTGAGTCGCATGAGTTTGACCCAGTTGGTTCAAAGCTTGTTTGGGAGCAAGTCTTAAAGCCTTTGTATGGTATGACCACAGACAAAACCGTTGTTGAAGAAGAAGAGGCTAAGCTAGCCAAAGTCCTCGATGTTTACGAACACAGGCTTGGTGAGTCCAAGTATTTGGCTTCTGACCACTTCACTTTGGTCGATCTTCACACTATCCCTGTGATTCAATACTTACTTGGAACTCCAACTAAGAAACTCTTCGACGAGCGTCCACATGTGAGTGCTTGGGTTGCTGACATCACTTCAAGGCCTTCTGCTCAGAAGGTTCTTTAA
Protein Sequence
- >AT1G02930.1
MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAQKVL - >AT1G02930.2
MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAQKVL