Information report for AT1G02920
Gene Details
|
|
Functional Descriptions
- PO:0000293 — guard cell — célula guardiana (Spanish, exact), occlusive cell (exact), 孔辺細胞 (Japanese, exact)
Functional Keywords
Literature and News
- MdKCS2 increased plant drought resistance by regulating wax biosynthesis. DOI: 10.1007/s00299-021-02776-4 ; PMID: 34468851
- NA DOI: NA ; PMID: 34894237
- Protein-protein interactions in fatty acid elongase complexes are important for very-long-chain fatty acid synthesis. DOI: 10.1093/jxb/erab543 ; PMID: 35560210
- A jojoba beta-Ketoacyl-CoA synthase cDNA complements the canola fatty acid elongation mutation in transgenic plants. DOI: 10.1105/tpc.8.2.281 ; PMID: 8742713
- Control of auxin-regulated root development by the Arabidopsis thaliana SHY2/IAA3 gene. DOI: 10.1242/dev.126.4.711 ; PMID: 9895319
- Photomorphogenic development of the Arabidopsis shy2-1D mutation and its interaction with phytochromes in darkness. DOI: 10.1046/j.1365-313x.1998.00179.x ; PMID: 9744095
- Two dominant photomorphogenic mutations of Arabidopsis thaliana identified as suppressor mutations of hy2. DOI: 10.1046/j.1365-313x.1996.09040441.x ; PMID: 8624510
- Aux/IAA proteins are phosphorylated by phytochrome in vitro. DOI: 10.1104/pp.124.4.1728 ; PMID: 11115889
- Arabidopsis SHY2/IAA3 inhibits auxin-regulated gene expression. DOI: 10.1105/tpc.010283 ; PMID: 11884676
- IAA17/AXR3: biochemical insight into an auxin mutant phenotype. DOI: 10.1105/tpc.13.4.829 ; PMID: 11283339
- Expression pattern of Aux/IAA genes in the iaa3/shy2-1D mutant of Arabidopsis thaliana (L.). DOI: 10.1093/aob/mcf007 ; PMID: 12096821
- Arabidopsis Aux/IAA genes are involved in brassinosteroid-mediated growth responses in a manner dependent on organ type. DOI: 10.1111/j.1365-313X.2005.02582.x ; PMID: 16367964
- Specificity and similarity of functions of the Aux/IAA genes in auxin signaling of Arabidopsis revealed by promoter-exchange experiments among MSG2/IAA19, AXR2/IAA7, and SLR/IAA14. DOI: 10.1104/pp.107.096628 ; PMID: 17369427
- A genetic framework for the control of cell division and differentiation in the root meristem. DOI: 10.1126/science.1164147 ; PMID: 19039136
- Auxin-induced, SCF(TIR1)-mediated poly-ubiquitination marks AUX/IAA proteins for degradation. DOI: 10.1111/j.1365-313X.2009.03854.x ; PMID: 19309453
- Developmental specificity of auxin response by pairs of ARF and Aux/IAA transcriptional regulators. DOI: 10.1038/sj.emboj.7600659 ; PMID: 15889151
- Plant Elongator regulates auxin-related genes during RNA polymerase II transcription elongation. DOI: 10.1073/pnas.0913559107 ; PMID: 20080602
- The rate of cell differentiation controls the Arabidopsis root meristem growth phase. DOI: 10.1016/j.cub.2010.05.035 ; PMID: 20605455
- TCP transcription factors regulate the activities of ASYMMETRIC LEAVES1 and miR164, as well as the auxin response, during differentiation of leaves in Arabidopsis. DOI: 10.1105/tpc.110.075598 ; PMID: 21119060
- Spatio-temporal sequence of cross-regulatory events in root meristem growth. DOI: 10.1073/pnas.1014716108 ; PMID: 21149702
- Identical amino acid substitutions in the repression domain of auxin/indole-3-acetic acid proteins have contrasting effects on auxin signaling. DOI: 10.1104/pp.110.171322 ; PMID: 21252300
- A stele-enriched gene regulatory network in the Arabidopsis root. DOI: 10.1038/msb.2010.114 ; PMID: 21245844
- The influence of cytokinin-auxin cross-regulation on cell-fate determination in Arabidopsis thaliana root development. DOI: 10.1016/j.jtbi.2011.05.011 ; PMID: 21640126
- The class I protein AtTCP15 modulates plant development through a pathway that overlaps with the one affected by CIN-like TCP proteins. DOI: 10.1093/jxb/err305 ; PMID: 22016421
- Deficiency in riboflavin biosynthesis affects tetrapyrrole biosynthesis in etiolated Arabidopsis tissue. DOI: 10.1007/s11103-011-9846-1 ; PMID: 22081402
- Multiple AUX/IAA-ARF modules regulate lateral root formation: the role of Arabidopsis SHY2/IAA3-mediated auxin signalling. DOI: 10.1098/rstb.2011.0232 ; PMID: 22527388
- PIF4-mediated activation of YUCCA8 expression integrates temperature into the auxin pathway in regulating arabidopsis hypocotyl growth. DOI: 10.1371/journal.pgen.1002594 ; PMID: 22479194
- Regulation of leaf morphology by microRNA394 and its target LEAF CURLING RESPONSIVENESS. DOI: 10.1093/pcp/pcs080 ; PMID: 22619471
- Control of root meristem size by DA1-RELATED PROTEIN2 in Arabidopsis. DOI: 10.1104/pp.112.210237 ; PMID: 23296689
- Strigolactone signaling in the endodermis is sufficient to restore root responses and involves SHORT HYPOCOTYL 2 (SHY2) activity. DOI: 10.1111/nph.12189 ; PMID: 23425316
- DAR2 acts as an important node connecting cytokinin, auxin, SHY2 and PLT1/2 in root meristem size control. DOI: 10.4161/psb.24226 ; PMID: 23518585
- A regulatory cascade involving class II ETHYLENE RESPONSE FACTOR transcriptional repressors operates in the progression of leaf senescence. DOI: 10.1104/pp.113.218115 ; PMID: 23629833
- The cotton transcription factor TCP14 functions in auxin-mediated epidermal cell differentiation and elongation. DOI: 10.1104/pp.113.215673 ; PMID: 23715527
- Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. DOI: 10.1016/j.cub.2013.07.051 ; PMID: 24035544
- Perturbation of auxin homeostasis caused by mitochondrial FtSH4 gene-mediated peroxidase accumulation regulates arabidopsis architecture. DOI: 10.1093/mp/ssu006 ; PMID: 24482432
- Identification of new adventitious rooting mutants amongst suppressors of the Arabidopsis thaliana superroot2 mutation. DOI: 10.1093/jxb/eru026 ; PMID: 24596172
- Putting theory to the test: which regulatory mechanisms can drive realistic growth of a root? DOI: 10.1371/journal.pcbi.1003910 ; PMID: 25358093
- OsTCP19 influences developmental and abiotic stress signaling by modulating ABI4-mediated pathways. DOI: 10.1038/srep09998 ; PMID: 25925167
- Ethylene Inhibits Cell Proliferation of the Arabidopsis Root Meristem. DOI: 10.1104/pp.15.00415 ; PMID: 26149574
- The Arabidopsis Auxin Receptor F-Box Proteins AFB4 and AFB5 Are Required for Response to the Synthetic Auxin Picloram. DOI: 10.1534/g3.115.025585 ; PMID: 26976444
- A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana. DOI: 10.1016/j.jtbi.2016.04.036 ; PMID: 27157127
- Drought-Up-Regulated TaNAC69-1 is a Transcriptional Repressor of TaSHY2 and TaIAA7, and Enhances Root Length and Biomass in Wheat. DOI: 10.1093/pcp/pcw126 ; PMID: 27440550
- The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth. DOI: 10.1371/journal.pgen.1006607 ; PMID: 28158182
- CBL-interacting protein kinase 25 contributes to root meristem development. DOI: 10.1093/jxb/ery334 ; PMID: 30239807
- SHY2 as a node in the regulation of root meristem development by auxin, brassinosteroids, and cytokinin. DOI: 10.1111/jipb.12931 ; PMID: 32239656
- IAA3-mediated repression of PIF proteins coordinates light and auxin signaling in Arabidopsis. DOI: 10.1371/journal.pgen.1009384 ; PMID: 33600444
- A network of stress-related genes regulates hypocotyl elongation downstream of selective auxin perception. DOI: 10.1093/plphys/kiab269 ; PMID: 34618142
- Transcriptional activation of auxin biosynthesis drives developmental reprogramming of differentiated cells. DOI: 10.1093/plcell/koac218 ; PMID: 35922895
- RAV1 mediates cytokinin signaling for regulating primary root growth in Arabidopsis. DOI: 10.1111/tpj.16039 ; PMID: 36423224
- Control of lateral root initiation by DA3 in Arabidopsis. DOI: 10.1016/j.celrep.2022.111913 ; PMID: 36640335
- Degradation of Aux/IAA proteins is essential for normal auxin signalling. DOI: 10.1046/j.1365-313x.2000.00703.x ; PMID: 10758506
- Changes in auxin response from mutations in an AUX/IAA gene. DOI: 10.1126/science.279.5355.1371 ; PMID: 9478901
- Mutations in the AXR3 gene of Arabidopsis result in altered auxin response including ectopic expression from the SAUR-AC1 promoter. DOI: 10.1046/j.1365-313x.1996.10030403.x ; PMID: 8811856
- Hormonal interactions in the control of Arabidopsis hypocotyl elongation. DOI: 10.1104/pp.124.2.553 ; PMID: 11027706
- Auxin regulates SCF(TIR1)-dependent degradation of AUX/IAA proteins. DOI: 10.1038/35104500 ; PMID: 11713520
- The Arabidopsis HOBBIT gene encodes a CDC27 homolog that links the plant cell cycle to progression of cell differentiation. DOI: 10.1101/gad.237302 ; PMID: 12368267
- AXR3 and SHY2 interact to regulate root hair development. DOI: 10.1242/dev.00659 ; PMID: 14534134
- Regulation of Arabidopsis SHY2/IAA3 protein turnover. DOI: 10.1046/j.1365-313x.2003.01909.x ; PMID: 14617065
- Why hypocotyl extension mutants need to be characterized at the cell level: a case study of axr3-1. DOI: 10.1093/jxb/erh115 ; PMID: 15073219
- RAC GTPases in tobacco and Arabidopsis mediate auxin-induced formation of proteolytically active nuclear protein bodies that contain AUX/IAA proteins. DOI: 10.1105/tpc.105.032987 ; PMID: 15994909
- Root gravitropism requires lateral root cap and epidermal cells for transport and response to a mobile auxin signal. DOI: 10.1038/ncb1316 ; PMID: 16244669
- Functional genomic analysis of the AUXIN/INDOLE-3-ACETIC ACID gene family members in Arabidopsis thaliana. DOI: 10.1105/tpc.105.036723 ; PMID: 16284307
- Somaclonal variation in micropropagated oil palm. Characterization of two novel genes with enhanced expression in epigenetically abnormal cell lines and in response to auxin. DOI: 10.1093/treephys/26.5.585 ; PMID: 16452072
Gene Resources
- UniProt: A0A178W5T1
- EMBL: CACRSJ010000104, CACSHJ010000087, LR881466
- AlphaFoldDB: A0A178W5T1
- EnsemblPlants: AT1G02920.1
- Gramene: AT1G02920.1
- KEGG: ath:AT1G02920
- Orthologous matrix: FNSRRVW
- ExpressionAtlas: AT1G02920
- InterPro: IPR004045, IPR004046, IPR010987
- PANTHER: PTHR43900, PTHR43900:SF47
- SUPFAM: SSF47616, SSF52833
- PROSITE: PS50404, PS50405
- Gene3D: 1.20.1050.10, 3.40.30.10
- OrthoDB: A0A178W5T1
- SWISS-MODEL: A0A178W5T1
- Conserved Domain Database: cd03053, cd03187
Homologs
Sequences
cDNA Sequence
- >AT1G02920.1
ATTTTCTCCGATTATATTGTTTTATAAGTTATATGAACAGTATATGAAAATCTTGAACCAATAGAAACGACGAATCATACGTTACTCAGCTTGACTATGAAATAACAAAGAGTATTCAAGCTTGGTGGCGCCGTTTGTTTTTTGTTTATTCACTAAGTTACTCTAATTTAGTTGTATAAATACACTCTCCCATTTGTGTATTTCTTTTCATCAACCACAAAGATCTCTCTACTTCAATAAATCTCCACCTTGCTTTAAGAACAAAGTCTTAACAAATGGCAGGAATCAAAGTTTTCGGTCACCCAGCTTCCACAGCCACTAGAAGAGTTCTCATCGCTCTTCACGAGAAGAATCTCGACTTTGAATTCGTTCATATCGAGCTCAAAGATGGTGAACACAAGAAAGAGCCTTTCATCTTCCGCAACCCTTTTGGTAAAGTTCCAGCCTTTGAAGATGGAGACTTCAAGCTTTTCGAATCAAGAGCAATCACTCAATACATAGCTCATTTTTACTCAGACAAAGGAAACCAACTTGTCTCCCTTGGCTCCAAGGACATTGCGGGCATAGCCATGGGCATTGAAATTGAATCGCATGAGTTTGACCCAGTTGGTTCAAAGCTTGTTTGGGAGCAAGTCTTAAAGCCTTTGTATGGTATGACCACAGACAAAACCGTTGTTGAAGAAGAAGAGGCTAAGCTAGCCAAGGTCCTCGATGTTTACGAACACAGGCTTGGTGAGTCCAAGTATTTGGCTTCTGATAAATTCACTTTGGTCGATCTTCACACTATCCCTGTGATTCAGTACTTGCTTGGTACACCAACTAAGAAACTCTTTGACGAGCGTCCACATGTCAGTGCTTGGGTTGCTGACATCACTTCTAGGCCTTCTGCTAAGAAGGTTCTTTAAGTGACTCACAAACTGTTAATCAGAAGATTGAATAAAGTGGCGATGACCTCATTGCCCTAATTCTCATAAACAATAAAAGTGGCGATGACCTAATTGCCAAATTCTCATACACTCTGTGATTTTTTTGTGTGTGTCTCCTCTGTTTTTTTTTTTTGGTTTGAATGTAATCTTCAATAATAATGAGTCTTGATATATAATAAAAATATATTTGGTAGCCTAAAGTTTAGCTACTAATAAGTAGTGTTGATCTCTTATGACCAAAAAAAAGAAAAGAAAATTAGTGTTGATCTCATTCTTGAAAGTTGACT
CDS Sequence
- >AT1G02920.1
ATGGCAGGAATCAAAGTTTTCGGTCACCCAGCTTCCACAGCCACTAGAAGAGTTCTCATCGCTCTTCACGAGAAGAATCTCGACTTTGAATTCGTTCATATCGAGCTCAAAGATGGTGAACACAAGAAAGAGCCTTTCATCTTCCGCAACCCTTTTGGTAAAGTTCCAGCCTTTGAAGATGGAGACTTCAAGCTTTTCGAATCAAGAGCAATCACTCAATACATAGCTCATTTTTACTCAGACAAAGGAAACCAACTTGTCTCCCTTGGCTCCAAGGACATTGCGGGCATAGCCATGGGCATTGAAATTGAATCGCATGAGTTTGACCCAGTTGGTTCAAAGCTTGTTTGGGAGCAAGTCTTAAAGCCTTTGTATGGTATGACCACAGACAAAACCGTTGTTGAAGAAGAAGAGGCTAAGCTAGCCAAGGTCCTCGATGTTTACGAACACAGGCTTGGTGAGTCCAAGTATTTGGCTTCTGATAAATTCACTTTGGTCGATCTTCACACTATCCCTGTGATTCAGTACTTGCTTGGTACACCAACTAAGAAACTCTTTGACGAGCGTCCACATGTCAGTGCTTGGGTTGCTGACATCACTTCTAGGCCTTCTGCTAAGAAGGTTCTTTAA
Protein Sequence
- >AT1G02920.1
MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPTKKLFDERPHVSAWVADITSRPSAKKVL